Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247227 686 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013247227 VERSION XM_013247227.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247227.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..686 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..686 /gene="LOC106083914" /note="acylphosphatase-2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106083914" CDS 108..398 /gene="LOC106083914" /codon_start=1 /product="acylphosphatase-2" /protein_id="XP_013102681.2" /db_xref="GeneID:106083914" /translation="MSKIMHCTFEVFGIVQGVSFRMFTEKQANKLGVRGWCMNTRDDT VKGEIEATPEAFAEMKTWLEKTGSPTSRIDKAVFGETKENSNFTFEKFSVRY" polyA_site 686 /gene="LOC106083914" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggcaccattc acgggcgttt ttgtgccctt tttcaatcat tatgacagtc gatcccagta 61 tctcatcact gttgcagggc aaagcaagtt tatcataaac ctacaaaatg tctaaaatta 121 tgcattgcac ctttgaagta tttggcattg tgcaaggggt ttccttccgc atgtttacag 181 aaaaacaggc caacaaattg ggagttcgcg gttggtgcat gaataccaga gatgacactg 241 tgaagggcga aatagaggct acacccgaag catttgcaga aatgaaaacg tggttagaga 301 aaactggaag tcctacaagt cgcattgata aagcagtatt tggagaaacg aaagagaatt 361 cgaattttac ttttgaaaaa ttttcggtta gatattaaac caacagagat tattaatatt 421 agttgaaaat tagtaggtca catatatcaa agtaaaggcc ggtactacgt tcgcttttcg 481 cgatattatc gccgatcact ttccgattgt acggattact tttttttcgt agattaaaaa 541 aatgtgtact atttcaaaaa agttgtagcg taaaacatgg cctttcatcg gtcaaaaacg 601 atagtagtgc cagcctcttt ttgttattaa ccttatagat tactggtact gataaaagtt 661 taataaaaaa gaacttttaa atttta