Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans acylphosphatase-2 (LOC106083914),


LOCUS       XM_013247227             686 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013247227
VERSION     XM_013247227.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247227.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..686
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..686
                     /gene="LOC106083914"
                     /note="acylphosphatase-2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106083914"
     CDS             108..398
                     /gene="LOC106083914"
                     /codon_start=1
                     /product="acylphosphatase-2"
                     /protein_id="XP_013102681.2"
                     /db_xref="GeneID:106083914"
                     /translation="MSKIMHCTFEVFGIVQGVSFRMFTEKQANKLGVRGWCMNTRDDT
                     VKGEIEATPEAFAEMKTWLEKTGSPTSRIDKAVFGETKENSNFTFEKFSVRY"
     polyA_site      686
                     /gene="LOC106083914"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggcaccattc acgggcgttt ttgtgccctt tttcaatcat tatgacagtc gatcccagta
       61 tctcatcact gttgcagggc aaagcaagtt tatcataaac ctacaaaatg tctaaaatta
      121 tgcattgcac ctttgaagta tttggcattg tgcaaggggt ttccttccgc atgtttacag
      181 aaaaacaggc caacaaattg ggagttcgcg gttggtgcat gaataccaga gatgacactg
      241 tgaagggcga aatagaggct acacccgaag catttgcaga aatgaaaacg tggttagaga
      301 aaactggaag tcctacaagt cgcattgata aagcagtatt tggagaaacg aaagagaatt
      361 cgaattttac ttttgaaaaa ttttcggtta gatattaaac caacagagat tattaatatt
      421 agttgaaaat tagtaggtca catatatcaa agtaaaggcc ggtactacgt tcgcttttcg
      481 cgatattatc gccgatcact ttccgattgt acggattact tttttttcgt agattaaaaa
      541 aatgtgtact atttcaaaaa agttgtagcg taaaacatgg cctttcatcg gtcaaaaacg
      601 atagtagtgc cagcctcttt ttgttattaa ccttatagat tactggtact gataaaagtt
      661 taataaaaaa gaacttttaa atttta