Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans E3 ubiquitin-protein ligase TRAIP


LOCUS       XM_013247193             865 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083898), mRNA.
ACCESSION   XM_013247193
VERSION     XM_013247193.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247193.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..865
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..865
                     /gene="LOC106083898"
                     /note="E3 ubiquitin-protein ligase TRAIP; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106083898"
     CDS             35..814
                     /gene="LOC106083898"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase TRAIP"
                     /protein_id="XP_013102647.2"
                     /db_xref="GeneID:106083898"
                     /translation="MSGLKLMCPICTDDVRETEEVDSTNCGHIFHSSCLEQWKERNST
                     CPQCRHKNPSTHKLFFIINDSDDETQVENSDLTAKLESSLKKIQNLKEKLEESNVNFL
                     SLEELYTVQEEQTKEMKNQMAELANNFENFLQLHALYCESEERARLLLQENERLTLEN
                     DYVNDQLDLKTPKIHTTSASPQYTASVENSIDDAPTAKSELEDRIKHLQQDNALLNKE
                     NSFKTKEVELKTKELSMLRRMLKETSILLDAYKEPQHTHET"
     polyA_site      865
                     /gene="LOC106083898"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acctacaaga agttaaagaa aaagccttag gaaaatgtct ggtttgaaat taatgtgccc
       61 aatttgtact gacgatgtgc gagaaaccga ggaagtagac agcaccaatt gcggtcacat
      121 ctttcattcg tcatgcttgg aacaatggaa ggaacgtaac tctacgtgtc cacaatgtcg
      181 ccataagaac ccttcaaccc ataagttgtt ttttatcatc aatgactccg acgacgaaac
      241 tcaagtggaa aatagtgacc taactgccaa actggaatca agtttaaaaa aaatacaaaa
      301 tcttaaagag aaattggaag aaagcaatgt taacttcctg agtttggagg agctctacac
      361 cgttcaagaa gaacaaacaa aggaaatgaa aaaccaaatg gcagaattgg ccaataattt
      421 tgaaaacttt ttgcagttac acgctttgta ttgcgagtct gaggaacggg ccagattgct
      481 gcttcaggag aatgaacgtc ttacgttaga gaatgattat gtcaacgatc agcttgatct
      541 taaaacacca aaaattcaca caacaagtgc atcacctcaa tacaccgctt cagtagaaaa
      601 tagcattgat gatgcaccaa ccgcaaagtc tgagctggaa gacagaataa aacatctaca
      661 acaagacaac gcccttctca ataaagaaaa tagtttcaaa acaaaagaag tggaattgaa
      721 aaccaaggaa ttatccatgt taaggcgaat gcttaaagaa acgagtatat tgttagatgc
      781 atataaggaa cctcaacata cccatgaaac ttaaataaaa agactgtgga aaagtgatta
      841 tctgttcgat ataagaagag aacaa