Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247193 865 bp mRNA linear INV 02-SEP-2023 (LOC106083898), mRNA. ACCESSION XM_013247193 VERSION XM_013247193.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247193.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..865 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..865 /gene="LOC106083898" /note="E3 ubiquitin-protein ligase TRAIP; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106083898" CDS 35..814 /gene="LOC106083898" /codon_start=1 /product="E3 ubiquitin-protein ligase TRAIP" /protein_id="XP_013102647.2" /db_xref="GeneID:106083898" /translation="MSGLKLMCPICTDDVRETEEVDSTNCGHIFHSSCLEQWKERNST CPQCRHKNPSTHKLFFIINDSDDETQVENSDLTAKLESSLKKIQNLKEKLEESNVNFL SLEELYTVQEEQTKEMKNQMAELANNFENFLQLHALYCESEERARLLLQENERLTLEN DYVNDQLDLKTPKIHTTSASPQYTASVENSIDDAPTAKSELEDRIKHLQQDNALLNKE NSFKTKEVELKTKELSMLRRMLKETSILLDAYKEPQHTHET" polyA_site 865 /gene="LOC106083898" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acctacaaga agttaaagaa aaagccttag gaaaatgtct ggtttgaaat taatgtgccc 61 aatttgtact gacgatgtgc gagaaaccga ggaagtagac agcaccaatt gcggtcacat 121 ctttcattcg tcatgcttgg aacaatggaa ggaacgtaac tctacgtgtc cacaatgtcg 181 ccataagaac ccttcaaccc ataagttgtt ttttatcatc aatgactccg acgacgaaac 241 tcaagtggaa aatagtgacc taactgccaa actggaatca agtttaaaaa aaatacaaaa 301 tcttaaagag aaattggaag aaagcaatgt taacttcctg agtttggagg agctctacac 361 cgttcaagaa gaacaaacaa aggaaatgaa aaaccaaatg gcagaattgg ccaataattt 421 tgaaaacttt ttgcagttac acgctttgta ttgcgagtct gaggaacggg ccagattgct 481 gcttcaggag aatgaacgtc ttacgttaga gaatgattat gtcaacgatc agcttgatct 541 taaaacacca aaaattcaca caacaagtgc atcacctcaa tacaccgctt cagtagaaaa 601 tagcattgat gatgcaccaa ccgcaaagtc tgagctggaa gacagaataa aacatctaca 661 acaagacaac gcccttctca ataaagaaaa tagtttcaaa acaaaagaag tggaattgaa 721 aaccaaggaa ttatccatgt taaggcgaat gcttaaagaa acgagtatat tgttagatgc 781 atataaggaa cctcaacata cccatgaaac ttaaataaaa agactgtgga aaagtgatta 841 tctgttcgat ataagaagag aacaa