Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247184 375 bp mRNA linear INV 02-SEP-2023 (LOC106083890), mRNA. ACCESSION XM_013247184 VERSION XM_013247184.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247184.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..375 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..375 /gene="LOC106083890" /note="uncharacterized LOC106083890; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106083890" CDS 1..375 /gene="LOC106083890" /codon_start=1 /product="uncharacterized protein LOC106083890" /protein_id="XP_013102638.2" /db_xref="GeneID:106083890" /translation="MANCKFVVLLLMVVILKEYATQAKVVDFSKDIKLQKYLKIHQCR QKCYLKTLMKTNTNAVKENLMNFSTCRGIPDCYMCYDYCQVLPKAVPDLAQKMCSDQV YCSKGCRIACSQHKILERPMEE" ORIGIN 1 atggcgaatt gtaaatttgt tgttctctta ttgatggttg taatactcaa ggagtatgcg 61 acacaggcta aagttgtaga tttctccaag gacatcaaac tgcagaaata tttgaagata 121 catcaatgtc gtcaaaagtg ttatttaaag actcttatga aaaccaacac caatgccgtt 181 aaggagaatt taatgaattt cagcacttgt cgcggtattc ctgattgtta catgtgctac 241 gattactgtc aagttctgcc caaggcggtt cctgatctgg ctcaaaagat gtgtagcgat 301 caggtctatt gttccaaggg ttgccgtatt gcatgttcac aacacaaaat attagagcga 361 cctatggagg agtag