PREDICTED: Stomoxys calcitrans uncharacterized LOC106083890

LOCUS       XM_013247184             375 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083890), mRNA.
ACCESSION   XM_013247184
VERSION     XM_013247184.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247184.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..375
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..375
                     /gene="LOC106083890"
                     /note="uncharacterized LOC106083890; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106083890"
     CDS             1..375
                     /gene="LOC106083890"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083890"
                     /protein_id="XP_013102638.2"
                     /db_xref="GeneID:106083890"
                     /translation="MANCKFVVLLLMVVILKEYATQAKVVDFSKDIKLQKYLKIHQCR
                     QKCYLKTLMKTNTNAVKENLMNFSTCRGIPDCYMCYDYCQVLPKAVPDLAQKMCSDQV
                     YCSKGCRIACSQHKILERPMEE"
ORIGIN      
        1 atggcgaatt gtaaatttgt tgttctctta ttgatggttg taatactcaa ggagtatgcg
       61 acacaggcta aagttgtaga tttctccaag gacatcaaac tgcagaaata tttgaagata
      121 catcaatgtc gtcaaaagtg ttatttaaag actcttatga aaaccaacac caatgccgtt
      181 aaggagaatt taatgaattt cagcacttgt cgcggtattc ctgattgtta catgtgctac
      241 gattactgtc aagttctgcc caaggcggtt cctgatctgg ctcaaaagat gtgtagcgat
      301 caggtctatt gttccaaggg ttgccgtatt gcatgttcac aacacaaaat attagagcga
      361 cctatggagg agtag