Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106083871


LOCUS       XM_013247151             849 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083871), mRNA.
ACCESSION   XM_013247151
VERSION     XM_013247151.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247151.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..849
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..849
                     /gene="LOC106083871"
                     /note="uncharacterized LOC106083871; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106083871"
     CDS             94..417
                     /gene="LOC106083871"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083871"
                     /protein_id="XP_013102605.1"
                     /db_xref="GeneID:106083871"
                     /translation="MKFVVFVCVLCSLLAWNEAAIGKARFNNPTNPGKCTIDTNFVLS
                     PGEKAKAPNNPCAGVTCLENGYAEFKTCDAVAPPKGCKLRDFVNINRSFPECCERTYD
                     CTKQI"
     misc_feature    196..402
                     /gene="LOC106083871"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
ORIGIN      
        1 gttgtgacca agacatcgta ctgttaatac agtttctcct tcaatacaaa ggaaaataac
       61 aagtgaaagt taaaacaaca gagagagaga aaaatgaaat tcgttgtgtt tgtatgtgtt
      121 ttgtgctcct tgttggcctg gaatgaagct gccattggca aggcccgttt taataatcca
      181 acgaatcccg gcaaatgtac cattgataca aatttcgtat tgtctcccgg cgagaaggct
      241 aaagccccca acaatccctg tgctggtgta acatgtctgg aaaatggtta tgccgaattc
      301 aaaacatgtg atgctgtggc accacctaaa ggttgcaaat tgcgtgattt tgtcaatatc
      361 aatcgcagtt ttcccgaatg ctgtgagcgc acctatgatt gcaccaaaca aatttaaggg
      421 aaaacaagca aaattagcca cctgagagaa gaaaaaaaga agaacaaata aaaaaaaaat
      481 taacaaaaaa atttaacaaa aaataattga acgaagacaa aaaaacaaag aagaccacta
      541 tttttaaaaa ggcataaaaa cgcggatctt ttgctgctac tacatcacaa agaaaaaaaa
      601 aatttaacat aaattttgtg aaacaaaaac aaaaaacaaa tcaacataaa ttcaacgtaa
      661 acaaagaaag gggtgtgtcg ccatcgtcat agtagtctct ttgtctacct ctcgaaacat
      721 cagtcatcag ccaccatcat catcattatc atcatctgca atagtattgt catgtttatg
      781 aagaagtaga ttgccgcgta atgtgatatt cagtctcatc ggcgcatgtg cgcaagtagg
      841 aagctgtta