Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247121 857 bp mRNA linear INV 02-SEP-2023 and III subunit RPABC1 (LOC106083854), mRNA. ACCESSION XM_013247121 VERSION XM_013247121.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247121.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..857 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..857 /gene="LOC106083854" /note="DNA-directed RNA polymerases I, II, and III subunit RPABC1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106083854" CDS 114..746 /gene="LOC106083854" /codon_start=1 /product="DNA-directed RNA polymerases I, II, and III subunit RPABC1" /protein_id="XP_013102575.1" /db_xref="GeneID:106083854" /translation="MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMF GDKPSEKRPARSDLIVLVAHNDDPTDQMFVFFPDEPKIGIKTIKTYCTRMQEENIHRA IVVVQAGMTPSAKQSLVDMAPKYILEQFLESELLINITEHELVPEHVVMTPEEKQELL ARYKLKENMLMRIQAGDPVSRYFGLKRGQVVKIIRSSETAGRYISYRLVC" misc_feature 114..743 /gene="LOC106083854" /note="DNA-directed RNA polymerase II subunit family protein; Provisional; Region: PLN03111" /db_xref="CDD:215582" polyA_site 857 /gene="LOC106083854" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tccatctggc gtgtagaatt ttgactttgc ggcgtgctgt ttattatttc tggatttctc 61 tattaacttt ttcggcttgc tttttgtata tttaataaaa actcaaccaa accatggatg 121 atgaagctga gacctacaaa ctatggcgta tacgaaaaac catcatgcaa cttagccacg 181 atagaggcta tttagtgaca caagatgaat tggatcagac acttgaacaa tttaaggaaa 241 tgtttggtga caaacccagt gagaagaggc ctgcacgctc cgatttgatt gttttggttg 301 cccacaacga tgatcccacc gatcaaatgt ttgtcttctt tcccgacgaa ccaaaaattg 361 gcataaaaac cataaagacc tattgtacgc gtatgcagga ggaaaatatt cacagggcta 421 ttgtagttgt acaggctggc atgactccct cggccaaaca gtctttggtc gatatggctc 481 ccaaatatat attggaacaa tttttagaat ctgaattatt gattaatata accgagcatg 541 agttggtacc ggagcatgtg gtcatgacac cggaggagaa acaagagctg ctggcacgtt 601 ataaactgaa agagaacatg ttgatgagaa ttcaagctgg tgatccggta tcgagatatt 661 ttggtcttaa acgtggtcaa gtggtgaaaa ttattcgttc ttcggaaaca gctggacgtt 721 atatttccta tcgtttggtt tgctgaagtc gaacaatagg aataactatt ttaagctatg 781 ataaaatatt agatataatg aggtttgcag atggaatcaa taacaaatga cgatataaag 841 gcgaatgtta aacaaaa