Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans DNA-directed RNA polymerases I, II,


LOCUS       XM_013247121             857 bp    mRNA    linear   INV 02-SEP-2023
            and III subunit RPABC1 (LOC106083854), mRNA.
ACCESSION   XM_013247121
VERSION     XM_013247121.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247121.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..857
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..857
                     /gene="LOC106083854"
                     /note="DNA-directed RNA polymerases I, II, and III subunit
                     RPABC1; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins"
                     /db_xref="GeneID:106083854"
     CDS             114..746
                     /gene="LOC106083854"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I, II, and III
                     subunit RPABC1"
                     /protein_id="XP_013102575.1"
                     /db_xref="GeneID:106083854"
                     /translation="MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMF
                     GDKPSEKRPARSDLIVLVAHNDDPTDQMFVFFPDEPKIGIKTIKTYCTRMQEENIHRA
                     IVVVQAGMTPSAKQSLVDMAPKYILEQFLESELLINITEHELVPEHVVMTPEEKQELL
                     ARYKLKENMLMRIQAGDPVSRYFGLKRGQVVKIIRSSETAGRYISYRLVC"
     misc_feature    114..743
                     /gene="LOC106083854"
                     /note="DNA-directed RNA polymerase II subunit family
                     protein; Provisional; Region: PLN03111"
                     /db_xref="CDD:215582"
     polyA_site      857
                     /gene="LOC106083854"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tccatctggc gtgtagaatt ttgactttgc ggcgtgctgt ttattatttc tggatttctc
       61 tattaacttt ttcggcttgc tttttgtata tttaataaaa actcaaccaa accatggatg
      121 atgaagctga gacctacaaa ctatggcgta tacgaaaaac catcatgcaa cttagccacg
      181 atagaggcta tttagtgaca caagatgaat tggatcagac acttgaacaa tttaaggaaa
      241 tgtttggtga caaacccagt gagaagaggc ctgcacgctc cgatttgatt gttttggttg
      301 cccacaacga tgatcccacc gatcaaatgt ttgtcttctt tcccgacgaa ccaaaaattg
      361 gcataaaaac cataaagacc tattgtacgc gtatgcagga ggaaaatatt cacagggcta
      421 ttgtagttgt acaggctggc atgactccct cggccaaaca gtctttggtc gatatggctc
      481 ccaaatatat attggaacaa tttttagaat ctgaattatt gattaatata accgagcatg
      541 agttggtacc ggagcatgtg gtcatgacac cggaggagaa acaagagctg ctggcacgtt
      601 ataaactgaa agagaacatg ttgatgagaa ttcaagctgg tgatccggta tcgagatatt
      661 ttggtcttaa acgtggtcaa gtggtgaaaa ttattcgttc ttcggaaaca gctggacgtt
      721 atatttccta tcgtttggtt tgctgaagtc gaacaatagg aataactatt ttaagctatg
      781 ataaaatatt agatataatg aggtttgcag atggaatcaa taacaaatga cgatataaag
      841 gcgaatgtta aacaaaa