Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247116 551 bp mRNA linear INV 02-SEP-2023 (LOC106083853), mRNA. ACCESSION XM_013247116 VERSION XM_013247116.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247116.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..551 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..551 /gene="LOC106083853" /note="uncharacterized LOC106083853; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106083853" CDS 62..520 /gene="LOC106083853" /codon_start=1 /product="uncharacterized protein LOC106083853" /protein_id="XP_013102570.2" /db_xref="GeneID:106083853" /translation="MNSSKSFFAVGFTALCFFTYSYAIKCYSCESQSSCNSPRKVECN YQLANDTRSYLNIHHTEVNPNTTSPDMECLRENIKSNHGEYFYKGCIYTNIKACQLPL REIHSPNSTHHECDMCNFGDFCNPAGRTSFNIFVLVDTIIMGVIARYIWN" polyA_site 551 /gene="LOC106083853" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtgtagcga taatcgtttt agaaaaagcg acgaattatt ttttaagtac aaatatttgc 61 aatgaattcc tcgaaaagtt tttttgctgt tggctttacc gccctctgtt ttttcacata 121 ttcttacgcc attaaatgtt acagttgtga aagccagagt tcatgtaata gtcctagaaa 181 agtagaatgt aactatcaat tagccaatga cactcgctca tatttgaata ttcatcacac 241 cgaagttaat cccaatacaa caagtcctga tatggaatgt ttgagagaga atattaagag 301 caatcatgga gaatattttt ataaaggatg catctataca aacataaagg cttgtcaatt 361 gccactgcgt gagattcatt ccccaaatag tactcaccat gaatgcgata tgtgcaactt 421 tggggatttt tgtaatcctg caggtcgcac cagctttaac atttttgtcc tcgtagacac 481 aattattatg ggagtaatag ctcgctatat ttggaattaa aaaagaaggg gcactttagc 541 ctgactttaa a