Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106083853


LOCUS       XM_013247116             551 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083853), mRNA.
ACCESSION   XM_013247116
VERSION     XM_013247116.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247116.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..551
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..551
                     /gene="LOC106083853"
                     /note="uncharacterized LOC106083853; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106083853"
     CDS             62..520
                     /gene="LOC106083853"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083853"
                     /protein_id="XP_013102570.2"
                     /db_xref="GeneID:106083853"
                     /translation="MNSSKSFFAVGFTALCFFTYSYAIKCYSCESQSSCNSPRKVECN
                     YQLANDTRSYLNIHHTEVNPNTTSPDMECLRENIKSNHGEYFYKGCIYTNIKACQLPL
                     REIHSPNSTHHECDMCNFGDFCNPAGRTSFNIFVLVDTIIMGVIARYIWN"
     polyA_site      551
                     /gene="LOC106083853"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtgtagcga taatcgtttt agaaaaagcg acgaattatt ttttaagtac aaatatttgc
       61 aatgaattcc tcgaaaagtt tttttgctgt tggctttacc gccctctgtt ttttcacata
      121 ttcttacgcc attaaatgtt acagttgtga aagccagagt tcatgtaata gtcctagaaa
      181 agtagaatgt aactatcaat tagccaatga cactcgctca tatttgaata ttcatcacac
      241 cgaagttaat cccaatacaa caagtcctga tatggaatgt ttgagagaga atattaagag
      301 caatcatgga gaatattttt ataaaggatg catctataca aacataaagg cttgtcaatt
      361 gccactgcgt gagattcatt ccccaaatag tactcaccat gaatgcgata tgtgcaactt
      421 tggggatttt tgtaatcctg caggtcgcac cagctttaac atttttgtcc tcgtagacac
      481 aattattatg ggagtaatag ctcgctatat ttggaattaa aaaagaaggg gcactttagc
      541 ctgactttaa a