Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247115 976 bp mRNA linear INV 02-SEP-2023 (LOC106083852), mRNA. ACCESSION XM_013247115 VERSION XM_013247115.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247115.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..976 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..976 /gene="LOC106083852" /note="glutathione S-transferase theta-3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106083852" CDS 6..785 /gene="LOC106083852" /codon_start=1 /product="glutathione S-transferase theta-3" /protein_id="XP_013102569.1" /db_xref="GeneID:106083852" /translation="MVLPLNHCQLLKSKVRNNNNTTYKRKIIKMVNNLELYFDFISQP SRALYILLKQSGAKFEAKQINLLEAQNTNDDYKQINRFQKVPAIIDYESGEKFHLAES IAILRYLVTKGKILENFYPADFQQRARIDEFLCWQHNGIRTSCSLYFRFLWVQAKVFG APASDAKVAKYRKFMEADLQLMENQWLQSSQFLAGNNLSAADVFGACEIEQIRVCGYE IKEKYPKVFAWIERVRRELDPYFDEAHKVVYAFEKESKSKL" misc_feature 105..344 /gene="LOC106083852" /note="The thioredoxin (TRX)-like superfamily is a large, diverse group of proteins containing a TRX fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox...; Region: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; cl00388" /db_xref="CDD:469754" misc_feature 384..758 /gene="LOC106083852" /note="C-terminal, alpha helical domain of Class Theta Glutathione S-transferases; Region: GST_C_Theta; cd03183" /db_xref="CDD:198292" misc_feature order(387..392,399..401,408..413) /gene="LOC106083852" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198292" misc_feature order(417..419,429..434,441..446,450..455,465..467, 627..629,636..638) /gene="LOC106083852" /note="substrate binding pocket (H-site) [chemical binding]; other site" /db_xref="CDD:198292" misc_feature order(612..614,624..629,636..638,732..737,744..749) /gene="LOC106083852" /note="N-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:198292" polyA_site 976 /gene="LOC106083852" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttgcatggt attgccttta aaccattgtc aacttctaaa gagtaaagta cgaaataata 61 ataacacaac ctacaaaaga aaaataataa aaatggtaaa taatttagaa ttatactttg 121 attttatatc gcaaccatca agagccttat atatactttt gaaacaaagt ggtgccaaat 181 ttgaagcaaa acagattaat ctactggaag cccaaaatac caacgatgat tataagcaaa 241 tcaatcgttt ccaaaaagtg cctgcaatta ttgattatga atcgggtgaa aaatttcatt 301 tggccgaaag catagccata cttagatatt tggtaacaaa aggtaaaata ttggaaaact 361 tctatccagc agatttccag caacgagccc gcattgatga gtttctatgt tggcaacaca 421 atggcataag aacttcttgt tctctatatt tccgtttcct ttgggtacag gcgaaagttt 481 tcggtgcccc agcctccgat gccaaagtgg caaaatatcg caaatttatg gaagctgatt 541 tgcaactgat ggaaaatcaa tggttacaga gttcacaatt tttagctgga aataatttaa 601 gtgcagctga tgtatttgga gcgtgtgaaa ttgaacagat aagagtatgc ggctacgaaa 661 ttaaggaaaa atatcccaaa gtttttgcct ggattgaacg tgtacgccga gaactggatc 721 cctatttcga tgaagcccat aaagttgtgt atgcttttga aaaggaaagc aaatcaaaat 781 tgtagttcca ttaaatgcct ataacgaatt gattttggta atcgtttata ttttatactt 841 gtctggtttg ttcggctcga ggtcatgaaa acaattgttc aaaaactaat gttgtttttt 901 aaaacaattg tttacacgac ctcgagccga gcaaaccaga aaagtattaa ataaataggt 961 cagccatcac aacaca