Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247114 1171 bp mRNA linear INV 02-SEP-2023 (LOC106083851), mRNA. ACCESSION XM_013247114 VERSION XM_013247114.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247114.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1171 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1171 /gene="LOC106083851" /note="replication factor C subunit 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106083851" CDS 111..1112 /gene="LOC106083851" /codon_start=1 /product="replication factor C subunit 5" /protein_id="XP_013102568.2" /db_xref="GeneID:106083851" /translation="MSEENPAKTSRIPWVEKYRPSKLDDLISHEEIISTINRFINQKQ LPHLLFYGPPGTGKTSTILACAKQLYTPAQFKSMVLELNASDDRGIGIVRGQILNFAS TRTIFSGTFKLIILDEADAMTNDAQNALRRIIEKYTENVRFCVICNYLSKIIPAVQSR CTRFRFAPLTPEQILPRLDKIVEMENLNVTDDGKKALMILSKGDMRKVLNVLQSTSMA FDVVNEDNVYTCVGHPLRRDIERILETLLSCKSFEQAYDDIQSIKSVKGLALEDILTE LHLFIMRLELPMSVMNKIIIKMAAIEERLAKGCTEGPQTTALIAAFFIHRDHVTLES" polyA_site 1171 /gene="LOC106083851" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagttgttat agctcaaagg cgcaaaaagt tgtttatgtc gcaaagagcg accttattca 61 ttgtctcgaa aatctagttt taataatttt taaactcaaa tacttgcaaa atgtctgaag 121 agaatcctgc aaaaacttcc cgcattccat gggtggaaaa atatcgtccc tccaaattgg 181 atgatttgat atctcacgaa gaaattatat ctacaattaa tcgttttatt aatcaaaaac 241 agctgcccca cttgctgttc tatggtccac cgggtaccgg caaaacgagt acaatattgg 301 catgtgccaa acaattgtat acaccggcac aatttaaatc gatggttttg gaactgaatg 361 cttccgatga tcgtggcatt ggtatagttc gtggtcaaat attaaatttt gcatctacgc 421 gcaccatctt tagtggaact ttcaaattga ttatactcga tgaagccgat gccatgacca 481 atgatgccca gaatgctttg agacgcatca ttgagaaata tacggaaaat gtacgatttt 541 gtgttatatg caattatttg agtaaaatta taccagcggt acaatcgaga tgtacacgtt 601 ttcgttttgc ccccttgacg ccggaacaga tattgccacg tttggataaa attgtggaaa 661 tggaaaattt aaatgttacc gacgatggta aaaaggcgct gatgatactc tccaagggcg 721 atatgcgtaa agtgctcaat gttctgcaaa gtaccagcat ggcttttgat gttgtcaatg 781 aggataatgt ttatacttgt gttggccatc ctttgcgacg agatattgag agaatattgg 841 aaaccttatt gtcatgcaaa agcttcgagc aggcttatga tgatatacaa agtattaagt 901 cagttaaggg attggctttg gaagacattc ttacggaatt gcatttattt ataatgaggc 961 tggaacttcc tatgagcgtt atgaataaaa ttatcattaa aatggctgcc atcgaagagc 1021 gtttagccaa aggctgtacc gagggacctc aaacaacagc actgatagcc gccttcttta 1081 tacatcgaga tcatgttact ttagaaagtt aaaggaagga attttgtttt gttttttaag 1141 atatgtttaa taaacatttg tattaattta a