Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans replication factor C subunit 5


LOCUS       XM_013247114            1171 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083851), mRNA.
ACCESSION   XM_013247114
VERSION     XM_013247114.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247114.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1171
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1171
                     /gene="LOC106083851"
                     /note="replication factor C subunit 5; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:106083851"
     CDS             111..1112
                     /gene="LOC106083851"
                     /codon_start=1
                     /product="replication factor C subunit 5"
                     /protein_id="XP_013102568.2"
                     /db_xref="GeneID:106083851"
                     /translation="MSEENPAKTSRIPWVEKYRPSKLDDLISHEEIISTINRFINQKQ
                     LPHLLFYGPPGTGKTSTILACAKQLYTPAQFKSMVLELNASDDRGIGIVRGQILNFAS
                     TRTIFSGTFKLIILDEADAMTNDAQNALRRIIEKYTENVRFCVICNYLSKIIPAVQSR
                     CTRFRFAPLTPEQILPRLDKIVEMENLNVTDDGKKALMILSKGDMRKVLNVLQSTSMA
                     FDVVNEDNVYTCVGHPLRRDIERILETLLSCKSFEQAYDDIQSIKSVKGLALEDILTE
                     LHLFIMRLELPMSVMNKIIIKMAAIEERLAKGCTEGPQTTALIAAFFIHRDHVTLES"
     polyA_site      1171
                     /gene="LOC106083851"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagttgttat agctcaaagg cgcaaaaagt tgtttatgtc gcaaagagcg accttattca
       61 ttgtctcgaa aatctagttt taataatttt taaactcaaa tacttgcaaa atgtctgaag
      121 agaatcctgc aaaaacttcc cgcattccat gggtggaaaa atatcgtccc tccaaattgg
      181 atgatttgat atctcacgaa gaaattatat ctacaattaa tcgttttatt aatcaaaaac
      241 agctgcccca cttgctgttc tatggtccac cgggtaccgg caaaacgagt acaatattgg
      301 catgtgccaa acaattgtat acaccggcac aatttaaatc gatggttttg gaactgaatg
      361 cttccgatga tcgtggcatt ggtatagttc gtggtcaaat attaaatttt gcatctacgc
      421 gcaccatctt tagtggaact ttcaaattga ttatactcga tgaagccgat gccatgacca
      481 atgatgccca gaatgctttg agacgcatca ttgagaaata tacggaaaat gtacgatttt
      541 gtgttatatg caattatttg agtaaaatta taccagcggt acaatcgaga tgtacacgtt
      601 ttcgttttgc ccccttgacg ccggaacaga tattgccacg tttggataaa attgtggaaa
      661 tggaaaattt aaatgttacc gacgatggta aaaaggcgct gatgatactc tccaagggcg
      721 atatgcgtaa agtgctcaat gttctgcaaa gtaccagcat ggcttttgat gttgtcaatg
      781 aggataatgt ttatacttgt gttggccatc ctttgcgacg agatattgag agaatattgg
      841 aaaccttatt gtcatgcaaa agcttcgagc aggcttatga tgatatacaa agtattaagt
      901 cagttaaggg attggctttg gaagacattc ttacggaatt gcatttattt ataatgaggc
      961 tggaacttcc tatgagcgtt atgaataaaa ttatcattaa aatggctgcc atcgaagagc
     1021 gtttagccaa aggctgtacc gagggacctc aaacaacagc actgatagcc gccttcttta
     1081 tacatcgaga tcatgttact ttagaaagtt aaaggaagga attttgtttt gttttttaag
     1141 atatgtttaa taaacatttg tattaattta a