Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247113 654 bp mRNA linear INV 02-SEP-2023 (LOC106083850), transcript variant X2, mRNA. ACCESSION XM_013247113 VERSION XM_013247113.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247113.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..654 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..654 /gene="LOC106083850" /note="uncharacterized LOC106083850; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106083850" CDS 95..496 /gene="LOC106083850" /codon_start=1 /product="uncharacterized protein LOC106083850 isoform X2" /protein_id="XP_013102567.1" /db_xref="GeneID:106083850" /translation="MAYAIRCYSCDTKKACKSPKKVECNNGLANTTRAYLDFHHTGIN PNTTSPFIECMQERIKSNQGEFEYKGCVYSNINVCQLPLRDFHTSGRYERTCAKCNDK DLCNPAGRASISGFALIATVVMGLLVRKISA" polyA_site 654 /gene="LOC106083850" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tattaatgaa ataagaataa gaggaaaatt aaaaaaaaaa aaaataagtg taacggaatg 61 caagcaatat ttcataagag gtttcattct tgtcatggct tatgccatta gatgttacag 121 ttgtgacacc aagaaagcct gcaaaagtcc taaaaaggta gaatgtaaca atgggttggc 181 caataccact cgcgcttatt tggacttcca tcacactgga attaacccca acacaacaag 241 tccttttatt gaatgtatgc aagaacgcat caagagtaat caaggtgaat ttgaatacaa 301 aggatgtgtc tatagtaata taaacgtttg tcaattgcca ttgcgtgatt tccataccag 361 tggtagatat gaacgtacct gcgccaagtg caacgacaag gacctgtgta atcctgccgg 421 tcgtgccagc attagcggtt ttgcccttat agccacagtg gttatgggtc tgcttgttcg 481 aaaaatttcg gcttaggcca aagagagaga agcttaacca tagcttgcgg aatatattga 541 gaaactaaaa atctaaaaaa gtaaataaaa ttgttgtttt gttttttgaa atattaatgt 601 tgtaaataaa atattgagca gtaaaatttt gataaataaa atttttagca taaa