Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106083850


LOCUS       XM_013247113             654 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083850), transcript variant X2, mRNA.
ACCESSION   XM_013247113
VERSION     XM_013247113.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247113.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..654
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..654
                     /gene="LOC106083850"
                     /note="uncharacterized LOC106083850; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106083850"
     CDS             95..496
                     /gene="LOC106083850"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083850 isoform X2"
                     /protein_id="XP_013102567.1"
                     /db_xref="GeneID:106083850"
                     /translation="MAYAIRCYSCDTKKACKSPKKVECNNGLANTTRAYLDFHHTGIN
                     PNTTSPFIECMQERIKSNQGEFEYKGCVYSNINVCQLPLRDFHTSGRYERTCAKCNDK
                     DLCNPAGRASISGFALIATVVMGLLVRKISA"
     polyA_site      654
                     /gene="LOC106083850"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tattaatgaa ataagaataa gaggaaaatt aaaaaaaaaa aaaataagtg taacggaatg
       61 caagcaatat ttcataagag gtttcattct tgtcatggct tatgccatta gatgttacag
      121 ttgtgacacc aagaaagcct gcaaaagtcc taaaaaggta gaatgtaaca atgggttggc
      181 caataccact cgcgcttatt tggacttcca tcacactgga attaacccca acacaacaag
      241 tccttttatt gaatgtatgc aagaacgcat caagagtaat caaggtgaat ttgaatacaa
      301 aggatgtgtc tatagtaata taaacgtttg tcaattgcca ttgcgtgatt tccataccag
      361 tggtagatat gaacgtacct gcgccaagtg caacgacaag gacctgtgta atcctgccgg
      421 tcgtgccagc attagcggtt ttgcccttat agccacagtg gttatgggtc tgcttgttcg
      481 aaaaatttcg gcttaggcca aagagagaga agcttaacca tagcttgcgg aatatattga
      541 gaaactaaaa atctaaaaaa gtaaataaaa ttgttgtttt gttttttgaa atattaatgt
      601 tgtaaataaa atattgagca gtaaaatttt gataaataaa atttttagca taaa