Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247112 703 bp mRNA linear INV 02-SEP-2023 (LOC106083850), transcript variant X1, mRNA. ACCESSION XM_013247112 VERSION XM_013247112.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247112.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..703 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..703 /gene="LOC106083850" /note="uncharacterized LOC106083850; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106083850" CDS 87..545 /gene="LOC106083850" /codon_start=1 /product="uncharacterized protein LOC106083850 isoform X1" /protein_id="XP_013102566.1" /db_xref="GeneID:106083850" /translation="MNSSKILFVIGIIALSCVTYTYAIRCYSCDTKKACKSPKKVECN NGLANTTRAYLDFHHTGINPNTTSPFIECMQERIKSNQGEFEYKGCVYSNINVCQLPL RDFHTSGRYERTCAKCNDKDLCNPAGRASISGFALIATVVMGLLVRKISA" polyA_site 703 /gene="LOC106083850" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgtttagcg gtaatcgtaa cgttttctaa cacagaataa tttttaacgc gaattgtaaa 61 attttgaaaa aagaacacat tttacaatga attcttcaaa aattttattt gtgattggca 121 taattgccct aagttgtgtt acgtacactt atgccattag atgttacagt tgtgacacca 181 agaaagcctg caaaagtcct aaaaaggtag aatgtaacaa tgggttggcc aataccactc 241 gcgcttattt ggacttccat cacactggaa ttaaccccaa cacaacaagt ccttttattg 301 aatgtatgca agaacgcatc aagagtaatc aaggtgaatt tgaatacaaa ggatgtgtct 361 atagtaatat aaacgtttgt caattgccat tgcgtgattt ccataccagt ggtagatatg 421 aacgtacctg cgccaagtgc aacgacaagg acctgtgtaa tcctgccggt cgtgccagca 481 ttagcggttt tgcccttata gccacagtgg ttatgggtct gcttgttcga aaaatttcgg 541 cttaggccaa agagagagaa gcttaaccat agcttgcgga atatattgag aaactaaaaa 601 tctaaaaaag taaataaaat tgttgttttg ttttttgaaa tattaatgtt gtaaataaaa 661 tattgagcag taaaattttg ataaataaaa tttttagcat aaa