Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106083850


LOCUS       XM_013247112             703 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083850), transcript variant X1, mRNA.
ACCESSION   XM_013247112
VERSION     XM_013247112.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247112.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..703
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..703
                     /gene="LOC106083850"
                     /note="uncharacterized LOC106083850; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106083850"
     CDS             87..545
                     /gene="LOC106083850"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083850 isoform X1"
                     /protein_id="XP_013102566.1"
                     /db_xref="GeneID:106083850"
                     /translation="MNSSKILFVIGIIALSCVTYTYAIRCYSCDTKKACKSPKKVECN
                     NGLANTTRAYLDFHHTGINPNTTSPFIECMQERIKSNQGEFEYKGCVYSNINVCQLPL
                     RDFHTSGRYERTCAKCNDKDLCNPAGRASISGFALIATVVMGLLVRKISA"
     polyA_site      703
                     /gene="LOC106083850"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgtttagcg gtaatcgtaa cgttttctaa cacagaataa tttttaacgc gaattgtaaa
       61 attttgaaaa aagaacacat tttacaatga attcttcaaa aattttattt gtgattggca
      121 taattgccct aagttgtgtt acgtacactt atgccattag atgttacagt tgtgacacca
      181 agaaagcctg caaaagtcct aaaaaggtag aatgtaacaa tgggttggcc aataccactc
      241 gcgcttattt ggacttccat cacactggaa ttaaccccaa cacaacaagt ccttttattg
      301 aatgtatgca agaacgcatc aagagtaatc aaggtgaatt tgaatacaaa ggatgtgtct
      361 atagtaatat aaacgtttgt caattgccat tgcgtgattt ccataccagt ggtagatatg
      421 aacgtacctg cgccaagtgc aacgacaagg acctgtgtaa tcctgccggt cgtgccagca
      481 ttagcggttt tgcccttata gccacagtgg ttatgggtct gcttgttcga aaaatttcgg
      541 cttaggccaa agagagagaa gcttaaccat agcttgcgga atatattgag aaactaaaaa
      601 tctaaaaaag taaataaaat tgttgttttg ttttttgaaa tattaatgtt gtaaataaaa
      661 tattgagcag taaaattttg ataaataaaa tttttagcat aaa