Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans glutathione S-transferase theta-1


LOCUS       XM_013247111             937 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083849), mRNA.
ACCESSION   XM_013247111
VERSION     XM_013247111.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247111.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..937
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..937
                     /gene="LOC106083849"
                     /note="glutathione S-transferase theta-1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 24 Proteins"
                     /db_xref="GeneID:106083849"
     CDS             58..732
                     /gene="LOC106083849"
                     /codon_start=1
                     /product="glutathione S-transferase theta-1"
                     /protein_id="XP_013102565.2"
                     /db_xref="GeneID:106083849"
                     /translation="MSLAYYYDLMSQPSRALYIILKMSGVQFEDCPVALRKGAHLTED
                     FKTNINRFQKVPCINDGGFKLAESIAILRYLSAKGKIPEHLYPKNVVEQARVDEFLEW
                     QHITLRITCALYFRAKWLDPMLTGKKASEDKLASLKTHMETNLAIVENLWLESTDFLC
                     GNQMTVADIFAACEIEQPRMADYDVRAHYPKIRAWLQRVREACGPHYDYAHQFVYKIC
                     GSEPTN"
     polyA_site      937
                     /gene="LOC106083849"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aataaataat gacaaattat ttacagattt ttgtgcaaaa attcttaaac aaacaaaatg
       61 tcgttggcct attactatga tctgatgtct cagccgtcga gggctttgta tattatttta
      121 aaaatgagtg gagtacaatt tgaggattgt ccggtggcac taagaaaggg tgctcatttg
      181 accgaggatt tcaaaaccaa cattaatcgc ttccaaaaag ttccctgtat aaacgatggc
      241 ggatttaaac tggccgagag tattgctata ttaagatatc taagtgccaa gggtaaaata
      301 cccgaacatc tttatcccaa aaatgttgtg gaacaggccc gcgtcgatga attcttggag
      361 tggcaacata taacattgcg catcacctgt gccctttatt tccgtgcaaa atggctggac
      421 cccatgctga cgggcaaaaa ggcatcagaa gataaattgg catcactgaa aactcacatg
      481 gaaaccaatt tggccatcgt ggaaaatttg tggttagaga gtacagattt tctgtgtggc
      541 aatcaaatga cggtggccga tatttttgct gcttgtgaaa ttgagcagcc acgtatggca
      601 gattacgatg tacgtgctca ttatcctaaa atccgtgctt ggttgcagcg tgtacgtgaa
      661 gcttgtggtc cacattatga ttatgcccat caatttgtat ataaaatctg tggatcggag
      721 ccaactaact aaaaagtgaa gaaaaggaga tagatgctta ctttttcgtt tactatttca
      781 tatgcttcgt aaggggctat gtacatgtat tctctacagt gaagtagtaa aaatagtcca
      841 acgacgtttt atatatctct taaaatgttt tataatttgt taatacatac tttattaact
      901 aaaataaagg aagtttgccc atttggccga aaactaa