Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013247110 1060 bp mRNA linear INV 02-SEP-2023 (LOC106083848), mRNA. ACCESSION XM_013247110 VERSION XM_013247110.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013247110.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1060 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1060 /gene="LOC106083848" /note="glutathione S-transferase theta-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins" /db_xref="GeneID:106083848" CDS 101..781 /gene="LOC106083848" /codon_start=1 /product="glutathione S-transferase theta-1" /protein_id="XP_013102564.1" /db_xref="GeneID:106083848" /translation="MSLAYYYDFMSQPSRALYIILKMSGVQFEDCPVALRNGEHLTEE FKTNINRFQKVPCIIDDGFKLAESIAVLRYLSAKGKIPEYLYPKYFVEQARVDEFLEW QHITLRITCALYFRTIWLEPLLSGKRPSPEKVETLKAHMELNLDIVENVWLESTDFLC GNQMTVADIFAACEIEQTRMADYDVRIKHPKIRAWLKRVRAACNPHYDHAHQYVYKIS GTAPNSKL" misc_feature 107..337 /gene="LOC106083848" /note="GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with...; Region: GST_N_Theta; cd03050" /db_xref="CDD:239348" misc_feature order(125..130,134..136,143..148,152..160,167..169, 209..211) /gene="LOC106083848" /note="C-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature order(131..136,218..223,260..265,299..304) /gene="LOC106083848" /note="GSH binding site (G-site) [chemical binding]; other site" /db_xref="CDD:239348" misc_feature 134..136 /gene="LOC106083848" /note="sulfate binding site [active]" /db_xref="CDD:239348" misc_feature order(251..253,287..292,296..301,308..310) /gene="LOC106083848" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature 374..751 /gene="LOC106083848" /note="C-terminal, alpha helical domain of Class Theta Glutathione S-transferases; Region: GST_C_Theta; cd03183" /db_xref="CDD:198292" misc_feature order(380..385,392..394,401..406) /gene="LOC106083848" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198292" misc_feature order(410..412,422..427,434..439,443..448,458..460, 620..622,629..631) /gene="LOC106083848" /note="substrate binding pocket (H-site) [chemical binding]; other site" /db_xref="CDD:198292" misc_feature order(605..607,617..622,629..631,725..730,737..742) /gene="LOC106083848" /note="N-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:198292" polyA_site 1060 /gene="LOC106083848" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtggcagaga gaaagtcaac gtattgacat actggccata caacgcattg cgtttagttg 61 tttggtgctc ttaaagtagg tttcgttata cttcaacaaa atgtctttgg catattacta 121 tgattttatg tcccagccat cgagggcttt gtatataata ctaaaaatga gtggagtaca 181 atttgaggat tgtccggtgg cattaagaaa tggtgaacat ttgaccgaag aatttaaaac 241 caatataaat cgtttccaga aagtgccatg tataatcgat gatggcttta aattagcaga 301 gagtatagct gtattgagat atttaagtgc caagggtaaa atacccgaat acctatatcc 361 caaatatttt gtggaacagg ctcgagttga tgaattccta gaatggcaac acataacatt 421 gcgcatcaca tgtgctttat atttccgtac catatggctg gaacccttgt tatcggggaa 481 aaggccatca ccagaaaagg tggaaacatt aaaggctcac atggaattga atctggacat 541 tgtggaaaat gtatggttgg agagtacaga ctttttgtgc ggcaatcaaa tgacagtggc 601 agatattttt gcggcctgtg agattgagca gacacgtatg gccgattatg atgttcgcat 661 taaacatccc aaaatccgtg catggttgaa acgtgtgcgt gccgcttgta atccccacta 721 tgatcatgcc catcagtatg tgtataaaat cagtggcacc gcaccgaatt caaaacttta 781 aaggagtggt ataaatgttt gtttgttgtg atgatccctg agccagttgt agggataatc 841 cacttaggta taccatttta aacgctggaa acatttttcc aaatgttatt acatgtagct 901 tataaatgat ttgttttacg ttgttggttg aattcgtctg atatgagtga ttttgttcgg 961 tttttgttta atttaatttt attacttcat aagtaaataa aaacaaaaga cactagactg 1021 tatgttgtct gtgcacgaca ttttatgtta aaatcttaaa