Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans glutathione S-transferase theta-1


LOCUS       XM_013247110            1060 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083848), mRNA.
ACCESSION   XM_013247110
VERSION     XM_013247110.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013247110.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1060
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1060
                     /gene="LOC106083848"
                     /note="glutathione S-transferase theta-1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 15 Proteins"
                     /db_xref="GeneID:106083848"
     CDS             101..781
                     /gene="LOC106083848"
                     /codon_start=1
                     /product="glutathione S-transferase theta-1"
                     /protein_id="XP_013102564.1"
                     /db_xref="GeneID:106083848"
                     /translation="MSLAYYYDFMSQPSRALYIILKMSGVQFEDCPVALRNGEHLTEE
                     FKTNINRFQKVPCIIDDGFKLAESIAVLRYLSAKGKIPEYLYPKYFVEQARVDEFLEW
                     QHITLRITCALYFRTIWLEPLLSGKRPSPEKVETLKAHMELNLDIVENVWLESTDFLC
                     GNQMTVADIFAACEIEQTRMADYDVRIKHPKIRAWLKRVRAACNPHYDHAHQYVYKIS
                     GTAPNSKL"
     misc_feature    107..337
                     /gene="LOC106083848"
                     /note="GST_N family, Class Theta subfamily; composed of
                     eukaryotic class Theta GSTs and bacterial dichloromethane
                     (DCM) dehalogenase. GSTs are cytosolic dimeric proteins
                     involved in cellular detoxification by catalyzing the
                     conjugation of glutathione (GSH) with...; Region:
                     GST_N_Theta; cd03050"
                     /db_xref="CDD:239348"
     misc_feature    order(125..130,134..136,143..148,152..160,167..169,
                     209..211)
                     /gene="LOC106083848"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239348"
     misc_feature    order(131..136,218..223,260..265,299..304)
                     /gene="LOC106083848"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239348"
     misc_feature    134..136
                     /gene="LOC106083848"
                     /note="sulfate binding site [active]"
                     /db_xref="CDD:239348"
     misc_feature    order(251..253,287..292,296..301,308..310)
                     /gene="LOC106083848"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239348"
     misc_feature    374..751
                     /gene="LOC106083848"
                     /note="C-terminal, alpha helical domain of Class Theta
                     Glutathione S-transferases; Region: GST_C_Theta; cd03183"
                     /db_xref="CDD:198292"
     misc_feature    order(380..385,392..394,401..406)
                     /gene="LOC106083848"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198292"
     misc_feature    order(410..412,422..427,434..439,443..448,458..460,
                     620..622,629..631)
                     /gene="LOC106083848"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198292"
     misc_feature    order(605..607,617..622,629..631,725..730,737..742)
                     /gene="LOC106083848"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198292"
     polyA_site      1060
                     /gene="LOC106083848"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtggcagaga gaaagtcaac gtattgacat actggccata caacgcattg cgtttagttg
       61 tttggtgctc ttaaagtagg tttcgttata cttcaacaaa atgtctttgg catattacta
      121 tgattttatg tcccagccat cgagggcttt gtatataata ctaaaaatga gtggagtaca
      181 atttgaggat tgtccggtgg cattaagaaa tggtgaacat ttgaccgaag aatttaaaac
      241 caatataaat cgtttccaga aagtgccatg tataatcgat gatggcttta aattagcaga
      301 gagtatagct gtattgagat atttaagtgc caagggtaaa atacccgaat acctatatcc
      361 caaatatttt gtggaacagg ctcgagttga tgaattccta gaatggcaac acataacatt
      421 gcgcatcaca tgtgctttat atttccgtac catatggctg gaacccttgt tatcggggaa
      481 aaggccatca ccagaaaagg tggaaacatt aaaggctcac atggaattga atctggacat
      541 tgtggaaaat gtatggttgg agagtacaga ctttttgtgc ggcaatcaaa tgacagtggc
      601 agatattttt gcggcctgtg agattgagca gacacgtatg gccgattatg atgttcgcat
      661 taaacatccc aaaatccgtg catggttgaa acgtgtgcgt gccgcttgta atccccacta
      721 tgatcatgcc catcagtatg tgtataaaat cagtggcacc gcaccgaatt caaaacttta
      781 aaggagtggt ataaatgttt gtttgttgtg atgatccctg agccagttgt agggataatc
      841 cacttaggta taccatttta aacgctggaa acatttttcc aaatgttatt acatgtagct
      901 tataaatgat ttgttttacg ttgttggttg aattcgtctg atatgagtga ttttgttcgg
      961 tttttgttta atttaatttt attacttcat aagtaaataa aaacaaaaga cactagactg
     1021 tatgttgtct gtgcacgaca ttttatgtta aaatcttaaa