Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246694 1001 bp mRNA linear INV 02-SEP-2023 (LOC106083576), mRNA. ACCESSION XM_013246694 VERSION XM_013246694.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246694.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1001 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1001 /gene="LOC106083576" /note="uncharacterized LOC106083576; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106083576" CDS 84..884 /gene="LOC106083576" /codon_start=1 /product="uncharacterized protein LOC106083576" /protein_id="XP_013102148.2" /db_xref="GeneID:106083576" /translation="MASENVEDWDQPLPMPMDSPDSGDEGLSYEDRVYKANMGKLQKY VEKMCYAPVKPPKANLIIENLSKPKKIQIVCTAENYSQTAEPPERGQRYKRLASKYKT MTTDELQQIIRANNLKASQKENMQKRKHEIYYDMLNKLEQRSRSQYLKFLANKFINFV AKLATTMNIPSTLVDPYARMQRGLFCDILLAIGVQPSSQAAVYYNSKEASEYEVCHRL SHAILSLVIKALDSAATRNVDNLQPIQADFDMDSYIKDRLMSAADRKV" polyA_site 1001 /gene="LOC106083576" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcttttgttt tcatatcaaa ttcatattta gttacgcatt gttagatcat ttttttttaa 61 atattatcta aattttctgc aaaatggcca gtgaaaatgt agaagattgg gaccagcctt 121 taccaatgcc aatggactct ccagatagtg gtgacgaagg gctgtcatat gaagatcggg 181 tttataaagc aaacatgggt aaattacaaa aatacgtgga gaaaatgtgt tatgctcctg 241 tcaaaccccc gaaagcaaat ctgattatag agaatttgtc caagcccaag aaaattcaaa 301 ttgtttgtac tgctgagaat tatagccaaa ctgcagagcc tccagaaaga ggccagcgtt 361 ataaacgctt agcaagcaaa tataagacca tgactacaga tgaattgcaa caaattataa 421 gagcaaataa tttgaaggca tctcaaaagg agaacatgca gaaacgtaaa catgaaatct 481 actatgatat gctaaataaa ttggaacagc gaagtcgttc gcaatatttg aaattcttgg 541 ccaacaaatt tataaatttt gtggcaaaac tagctacaac aatgaatata ccttccacat 601 tggtcgatcc ctatgcacgc atgcaacgcg gacttttttg tgacatctta ttggctatcg 661 gtgttcagcc tagtagtcaa gcagctgtgt actacaattc aaaagaggca agtgaatacg 721 aggtgtgtca cagactctcc catgccatac tcagtttggt cataaaagct ttggactcag 781 ccgcaacaag aaatgtggat aacctgcaac ccatacaagc ggacttcgac atggacagtt 841 atattaaaga tcgcctaatg agcgccgctg acaggaaagt ataaaaggca atttcaatgg 901 gatattcgtt ctattagtcg aaaaacaaat ttacttaaat actcaacatt ttgaacttgt 961 cgttagacgc aataaattaa aatacatttt gaaaccaaaa a