Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans diphthine methyltransferase


LOCUS       XM_013246650            1320 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083558), transcript variant X1, mRNA.
ACCESSION   XM_013246650
VERSION     XM_013246650.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246650.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1320
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1320
                     /gene="LOC106083558"
                     /note="diphthine methyltransferase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106083558"
     CDS             40..1212
                     /gene="LOC106083558"
                     /codon_start=1
                     /product="diphthine methyltransferase isoform X1"
                     /protein_id="XP_013102104.2"
                     /db_xref="GeneID:106083558"
                     /translation="MPHSVGRQNSNKSHAKTRIKSKYVGTELFVSQFIMMDIQLIHTI
                     DTEYSADSVEWCPHPDFKNLFVCGTYQLKESSEENHDATMAACHRKGRIYLYKFDESD
                     RSLLELNRVETAAILDMRWLKTTSNVFPILATATALGNVEVYIVEELKLKCVQVFRLN
                     PSENNLLTLSLDWGLSADEANISEGKQNQLLTSDSKGNISLAAWSSERNLEMIRSWHA
                     HEFEAWICAFDKWDKNLVYTGGDDTFLHVYDLRSETRSMVNKSHNAGVTCLLSHPKRE
                     KILLTGSYDEKLRTFDTRTMKTPLSELDLQGGIWRIKSDPVKHDLMLCACMYHNFSIV
                     DLCNVYSPSLVGKFEEHESICYGADWSTNVDDNFYMATCSFYDHKLCISSVNPSLK"
     polyA_site      1320
                     /gene="LOC106083558"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gacagttttt gacattttca tttttatgga tcgcaaaata tgccgcattc tgttggacga
       61 caaaactcaa acaaaagtca tgcaaagact cgcatcaaaa gcaaatacgt tggaacagag
      121 ttgtttgtgt ctcagttcat tatgatggac atacaactaa tccatactat tgatactgag
      181 tattctgcag actcggtgga atggtgtcca catcctgatt ttaaaaatct ctttgtatgt
      241 ggtacatatc agctgaaaga aagttctgag gaaaaccacg atgctacgat ggcggcatgt
      301 catcgcaaag gccgcatata tctttataag tttgatgaaa gtgatagatc acttttagag
      361 ctaaatcgtg tagaaactgc agcaattttg gacatgagat ggttgaaaac aacaagcaat
      421 gtttttccaa ttttagccac agcaacagca ttgggaaatg ttgaagtata cattgttgag
      481 gagctgaaat taaaatgtgt tcaggtcttt cgcctgaatc cgagtgaaaa caacttgcta
      541 acattatcac tagattgggg actttctgct gatgaagcca acatatctga aggtaaacaa
      601 aaccaacttc tcacttcgga ttccaaagga aatataagtc ttgcggcatg gtccagcgag
      661 agaaatcttg aaatgattcg cagttggcat gctcatgagt tcgaagcttg gatttgtgca
      721 tttgataaat gggacaaaaa tcttgtctac accgggggtg atgacacctt tttgcatgtg
      781 tacgatttgc gctccgagac tcgttccatg gtcaacaagt cccacaatgc aggtgtgaca
      841 tgtctactga gtcatccaaa gcgtgaaaag atcctcttga cgggcagtta tgatgaaaaa
      901 ttgcgtacat tcgatactag aacaatgaag acgccattga gtgagcttga cttgcagggt
      961 ggaatatggc gtataaaatc cgaccctgta aaacatgatt tgatgttatg cgcttgcatg
     1021 tatcataact tcagcattgt tgacctatgt aatgtttatt caccatcatt ggttggcaag
     1081 ttcgaggaac atgaaagcat atgctatggc gccgactggt ctacgaatgt ggatgacaac
     1141 ttttatatgg caacatgttc attttatgat cataaactat gcatctcaag tgttaatcct
     1201 tctttaaaat aaaatcaaat taaaacaaaa ctagttttat ttttcctgtg aatttactca
     1261 ttgcaaaata aagattttgt cgcgtgcgga atgtagcatg gtgtaaatta cttaattaaa