Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246644 598 bp mRNA linear INV 02-SEP-2023 (LOC106083556), mRNA. ACCESSION XM_013246644 VERSION XM_013246644.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246644.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..598 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..598 /gene="LOC106083556" /note="uncharacterized LOC106083556; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106083556" CDS 40..411 /gene="LOC106083556" /codon_start=1 /product="uncharacterized protein LOC106083556" /protein_id="XP_013102098.2" /db_xref="GeneID:106083556" /translation="MKIALCTLCLMAVLVAVSADADSAHFIPKAFYTLDSEGHKSDVH PINPHTAHYLRRLRRQTVSSSSSSSSVSSSSDGGPAFFSAQTINAHSDDLVGNVGHVV HTEGVLDTNGQLHINTQHGHF" polyA_site 598 /gene="LOC106083556" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gaatatcaat ataacaaaaa gaagaaaata atcttgaaaa tgaaaatcgc tttgtgcacc 61 ttgtgtttga tggctgtttt ggttgctgtt tccgctgatg ctgattcagc ccatttcata 121 cccaaggctt tctacacctt ggactctgag ggccacaaat ccgatgtaca tcccattaat 181 cctcatactg ctcattactt gagacgtttg cgtagacaaa ccgtctcatc atcttcctcc 241 tcatcgtccg tatcgtcttc gtccgatgga ggtccagctt ttttcagcgc tcaaactata 301 aatgcccata gcgatgattt agttggcaat gttggtcatg ttgtccatac cgagggcgta 361 ctcgacacta atggccagct ccatatcaac actcaacatg gtcacttcta attgaatgcg 421 agtgctcaat ttgaatcaaa aaattttttt caaatttatt ttctagtatt tttctgtatg 481 atgactttgt atgaaattta tacctcatct atgtatactg aactttatgt ttaatgttca 541 attttttcga aatttttatt tgcaaatata tatgtaaaat atttaccata gcatataa