Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106083556


LOCUS       XM_013246644             598 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083556), mRNA.
ACCESSION   XM_013246644
VERSION     XM_013246644.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246644.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..598
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..598
                     /gene="LOC106083556"
                     /note="uncharacterized LOC106083556; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106083556"
     CDS             40..411
                     /gene="LOC106083556"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083556"
                     /protein_id="XP_013102098.2"
                     /db_xref="GeneID:106083556"
                     /translation="MKIALCTLCLMAVLVAVSADADSAHFIPKAFYTLDSEGHKSDVH
                     PINPHTAHYLRRLRRQTVSSSSSSSSVSSSSDGGPAFFSAQTINAHSDDLVGNVGHVV
                     HTEGVLDTNGQLHINTQHGHF"
     polyA_site      598
                     /gene="LOC106083556"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gaatatcaat ataacaaaaa gaagaaaata atcttgaaaa tgaaaatcgc tttgtgcacc
       61 ttgtgtttga tggctgtttt ggttgctgtt tccgctgatg ctgattcagc ccatttcata
      121 cccaaggctt tctacacctt ggactctgag ggccacaaat ccgatgtaca tcccattaat
      181 cctcatactg ctcattactt gagacgtttg cgtagacaaa ccgtctcatc atcttcctcc
      241 tcatcgtccg tatcgtcttc gtccgatgga ggtccagctt ttttcagcgc tcaaactata
      301 aatgcccata gcgatgattt agttggcaat gttggtcatg ttgtccatac cgagggcgta
      361 ctcgacacta atggccagct ccatatcaac actcaacatg gtcacttcta attgaatgcg
      421 agtgctcaat ttgaatcaaa aaattttttt caaatttatt ttctagtatt tttctgtatg
      481 atgactttgt atgaaattta tacctcatct atgtatactg aactttatgt ttaatgttca
      541 attttttcga aatttttatt tgcaaatata tatgtaaaat atttaccata gcatataa