Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106083554


LOCUS       XM_013246643             766 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083554), mRNA.
ACCESSION   XM_013246643
VERSION     XM_013246643.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246643.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..766
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..766
                     /gene="LOC106083554"
                     /note="uncharacterized LOC106083554; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106083554"
     CDS             63..482
                     /gene="LOC106083554"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083554"
                     /protein_id="XP_013102097.1"
                     /db_xref="GeneID:106083554"
                     /translation="MFKFVLISCLLAAAIAMPIEQDDEDKAELERMQNESAQYSFSAQ
                     IDDQINDGTIAREETRDGTKVSGMYSYSDGFVMRTVHYEADENGYRVVKEETQDIGDG
                     PQFNANGQADVQGSLIGKYSIKLDTDDNERHYKDVRA"
     misc_feature    177..329
                     /gene="LOC106083554"
                     /note="Insect cuticle protein; Region: Chitin_bind_4;
                     pfam00379"
                     /db_xref="CDD:459790"
     polyA_site      766
                     /gene="LOC106083554"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgaaacgtg cacatcactc gattctacca ccaaaatcaa atcaactcca tttccaaaca
       61 aaatgttcaa atttgtgtta atctcttgcc tgttggccgc cgccattgcc atgccaattg
      121 aacaagacga tgaggacaag gccgaattgg aacgcatgca aaacgaatct gcccaatact
      181 ccttcagcgc tcaaatcgat gatcaaatca acgatggcac cattgcccgc gaagagaccc
      241 gtgatggcac caaggtcagc ggcatgtact cctacagcga tggctttgtt atgcgcaccg
      301 ttcactacga ggccgatgag aatggttatc gtgtagtcaa ggaggaaacc caagacatcg
      361 gtgatggtcc tcaattcaat gccaatggtc aagctgatgt tcaaggttct ttgattggca
      421 aatactccat caaattggat actgacgata acgaaagaca ctacaaggat gttcgtgcct
      481 aagaagtggc gaggcgtcaa aggatttcgg tgctcgtatc ctttaaagtg caaaaataaa
      541 aatgatgcat ttctaacatt tagaaataga gactgattga tccccagtat aggcgagttg
      601 aacaagaaga agacgaagaa gacacatcaa agtccattaa caaaaagaaa aataataaca
      661 catgcttttc atttttttgt tgtaatattg tttattaatt gtagtgtccc ttaactttat
      721 aaaaaaaact atgtatgtaa aataaattgt acgttttaag tggaaa