Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246643 766 bp mRNA linear INV 02-SEP-2023 (LOC106083554), mRNA. ACCESSION XM_013246643 VERSION XM_013246643.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246643.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..766 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..766 /gene="LOC106083554" /note="uncharacterized LOC106083554; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106083554" CDS 63..482 /gene="LOC106083554" /codon_start=1 /product="uncharacterized protein LOC106083554" /protein_id="XP_013102097.1" /db_xref="GeneID:106083554" /translation="MFKFVLISCLLAAAIAMPIEQDDEDKAELERMQNESAQYSFSAQ IDDQINDGTIAREETRDGTKVSGMYSYSDGFVMRTVHYEADENGYRVVKEETQDIGDG PQFNANGQADVQGSLIGKYSIKLDTDDNERHYKDVRA" misc_feature 177..329 /gene="LOC106083554" /note="Insect cuticle protein; Region: Chitin_bind_4; pfam00379" /db_xref="CDD:459790" polyA_site 766 /gene="LOC106083554" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgaaacgtg cacatcactc gattctacca ccaaaatcaa atcaactcca tttccaaaca 61 aaatgttcaa atttgtgtta atctcttgcc tgttggccgc cgccattgcc atgccaattg 121 aacaagacga tgaggacaag gccgaattgg aacgcatgca aaacgaatct gcccaatact 181 ccttcagcgc tcaaatcgat gatcaaatca acgatggcac cattgcccgc gaagagaccc 241 gtgatggcac caaggtcagc ggcatgtact cctacagcga tggctttgtt atgcgcaccg 301 ttcactacga ggccgatgag aatggttatc gtgtagtcaa ggaggaaacc caagacatcg 361 gtgatggtcc tcaattcaat gccaatggtc aagctgatgt tcaaggttct ttgattggca 421 aatactccat caaattggat actgacgata acgaaagaca ctacaaggat gttcgtgcct 481 aagaagtggc gaggcgtcaa aggatttcgg tgctcgtatc ctttaaagtg caaaaataaa 541 aatgatgcat ttctaacatt tagaaataga gactgattga tccccagtat aggcgagttg 601 aacaagaaga agacgaagaa gacacatcaa agtccattaa caaaaagaaa aataataaca 661 catgcttttc atttttttgt tgtaatattg tttattaatt gtagtgtccc ttaactttat 721 aaaaaaaact atgtatgtaa aataaattgt acgttttaag tggaaa