Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans calcyclin-binding protein


LOCUS       XM_013246642            1077 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083553), mRNA.
ACCESSION   XM_013246642
VERSION     XM_013246642.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246642.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1077
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1077
                     /gene="LOC106083553"
                     /note="calcyclin-binding protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106083553"
     CDS             112..792
                     /gene="LOC106083553"
                     /codon_start=1
                     /product="calcyclin-binding protein"
                     /protein_id="XP_013102096.1"
                     /db_xref="GeneID:106083553"
                     /translation="MSLAEELRKDSEEICKLLAEATRKRVKDALVKAKAEVDREIVNL
                     EMKEKQAAERKEAGPKRFYVELKEYGWDQSDKFVKIFVTLAGIQNIDESSVVIHFTEN
                     SLNLNINNFNGKDHVLVVNNLLHPIDVAKSYRKVKTDMVAIYMKKTLEGQHWPCLTSI
                     EKRLKDQADHELKQSSENPSDALVNIMKKMYNQGDSTTKQMIAKAWTESQEKIAKGGD
                     HNPLESLS"
     misc_feature    124..>282
                     /gene="LOC106083553"
                     /note="Siah interacting protein, N terminal; Region:
                     Siah-Interact_N; pfam09032"
                     /db_xref="CDD:462660"
     misc_feature    307..585
                     /gene="LOC106083553"
                     /note="p23_like domain found in proteins similar to
                     Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting
                     protein (SIP). CacyBP/SIP interacts with S100A6
                     (calcyclin), with some other members of the S100 family,
                     with tubulin, and with Siah-1 and Skp-1. The latter...;
                     Region: p23_CacyBP; cd06468"
                     /db_xref="CDD:107225"
     polyA_site      1077
                     /gene="LOC106083553"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgttattgt tttttcatta aaaacgaaac ttcgcgaatt tcaaacagtt tttcccacat
       61 tttataacat tgtctattgt gaaacaagag gaaagagaaa ggttaaacaa aatgtcactt
      121 gctgaagagc tgcgaaaaga ttccgaggaa atctgcaaat tgcttgcaga ggcaaccagg
      181 aagcgtgtca aggatgcctt ggtaaaagca aaagctgaag tggatcgtga gattgttaat
      241 ctggaaatga aggaaaagca ggcagcagaa cgtaaggaag caggacccaa aagattctac
      301 gtcgagctga aagaatacgg ttgggatcaa agtgacaagt tcgtgaaaat atttgttaca
      361 ttggctggta tccaaaatat cgatgaatca tcggtagtta tacatttcac cgaaaactct
      421 ttgaatttga atataaacaa tttcaatggc aaagaccatg tcttggtggt taacaacttg
      481 ctacatccca tcgacgttgc aaagagctat cgcaaagtta aaacagacat ggtggcgatt
      541 tacatgaaga aaacccttga aggccaacac tggccatgtc tgacttcgat cgaaaagcgt
      601 ctcaaagatc aagctgatca cgaattgaag caaagtagcg aaaacccttc cgatgctttg
      661 gttaatatca tgaagaaaat gtacaatcaa ggagattcaa cgacaaaaca aatgattgcc
      721 aaagcttgga cggaaagtca agaaaaaatt gcaaaaggag gagatcataa tcctttagag
      781 tctttaagtt aagaaaaaat cattacgtcg ccatgtttac aacatgtatc atatgaatct
      841 tagagttctt tttttgaatt gttttatgta caattctttc tattttgctc ttcgaagagc
      901 caatataaac gggtaattga aacgaaaaca ttgctattgg tagggcaaca tcccttatta
      961 aactttaaac aactgcattg tacaaatatt tattgattcc acattattac tttcgtttca
     1021 taaatacttt attagccata gatcatattt ttagtgtcaa taaaaataca gaacaaa