Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246642 1077 bp mRNA linear INV 02-SEP-2023 (LOC106083553), mRNA. ACCESSION XM_013246642 VERSION XM_013246642.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246642.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1077 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1077 /gene="LOC106083553" /note="calcyclin-binding protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106083553" CDS 112..792 /gene="LOC106083553" /codon_start=1 /product="calcyclin-binding protein" /protein_id="XP_013102096.1" /db_xref="GeneID:106083553" /translation="MSLAEELRKDSEEICKLLAEATRKRVKDALVKAKAEVDREIVNL EMKEKQAAERKEAGPKRFYVELKEYGWDQSDKFVKIFVTLAGIQNIDESSVVIHFTEN SLNLNINNFNGKDHVLVVNNLLHPIDVAKSYRKVKTDMVAIYMKKTLEGQHWPCLTSI EKRLKDQADHELKQSSENPSDALVNIMKKMYNQGDSTTKQMIAKAWTESQEKIAKGGD HNPLESLS" misc_feature 124..>282 /gene="LOC106083553" /note="Siah interacting protein, N terminal; Region: Siah-Interact_N; pfam09032" /db_xref="CDD:462660" misc_feature 307..585 /gene="LOC106083553" /note="p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP). CacyBP/SIP interacts with S100A6 (calcyclin), with some other members of the S100 family, with tubulin, and with Siah-1 and Skp-1. The latter...; Region: p23_CacyBP; cd06468" /db_xref="CDD:107225" polyA_site 1077 /gene="LOC106083553" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgttattgt tttttcatta aaaacgaaac ttcgcgaatt tcaaacagtt tttcccacat 61 tttataacat tgtctattgt gaaacaagag gaaagagaaa ggttaaacaa aatgtcactt 121 gctgaagagc tgcgaaaaga ttccgaggaa atctgcaaat tgcttgcaga ggcaaccagg 181 aagcgtgtca aggatgcctt ggtaaaagca aaagctgaag tggatcgtga gattgttaat 241 ctggaaatga aggaaaagca ggcagcagaa cgtaaggaag caggacccaa aagattctac 301 gtcgagctga aagaatacgg ttgggatcaa agtgacaagt tcgtgaaaat atttgttaca 361 ttggctggta tccaaaatat cgatgaatca tcggtagtta tacatttcac cgaaaactct 421 ttgaatttga atataaacaa tttcaatggc aaagaccatg tcttggtggt taacaacttg 481 ctacatccca tcgacgttgc aaagagctat cgcaaagtta aaacagacat ggtggcgatt 541 tacatgaaga aaacccttga aggccaacac tggccatgtc tgacttcgat cgaaaagcgt 601 ctcaaagatc aagctgatca cgaattgaag caaagtagcg aaaacccttc cgatgctttg 661 gttaatatca tgaagaaaat gtacaatcaa ggagattcaa cgacaaaaca aatgattgcc 721 aaagcttgga cggaaagtca agaaaaaatt gcaaaaggag gagatcataa tcctttagag 781 tctttaagtt aagaaaaaat cattacgtcg ccatgtttac aacatgtatc atatgaatct 841 tagagttctt tttttgaatt gttttatgta caattctttc tattttgctc ttcgaagagc 901 caatataaac gggtaattga aacgaaaaca ttgctattgg tagggcaaca tcccttatta 961 aactttaaac aactgcattg tacaaatatt tattgattcc acattattac tttcgtttca 1021 taaatacttt attagccata gatcatattt ttagtgtcaa taaaaataca gaacaaa