Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246170 660 bp mRNA linear INV 02-SEP-2023 (LOC106083258), mRNA. ACCESSION XM_013246170 VERSION XM_013246170.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246170.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..660 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..660 /gene="LOC106083258" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106083258" CDS 45..629 /gene="LOC106083258" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_013101624.2" /db_xref="GeneID:106083258" /translation="MDMTSLFKLEIVLLSGFLCGLAAAEPKWYTTSDGRRFLIDKEEK YNWFQASHECGRRNLQLLEIDSNEKNVLLMEDVLEKADIGDAYLWIGAIDEFSSSSNR DFYWTSSGRKMNFTHWMDGEPSTSDEHCVIMHGTCHNFLWDDRGCTSNWGFICEERYL DVGCKKDCKEEKNEAIKKYSELFISLLDDCSEFE" polyA_site 660 /gene="LOC106083258" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttcaaatat caagtggcca gtctaaattg cagcttttta atcgatggac atgacgtctc 61 tttttaagtt agaaattgtt ttattgagcg gctttctgtg tggcttggca gcggctgagc 121 cgaaatggta caccacctct gatggaagac gatttttgat tgataaagag gaaaagtaca 181 attggtttca agcttcgcac gaatgtgggc ggcgtaacct gcagttgctg gagatagact 241 cgaatgaaaa gaatgtatta cttatggagg atgtgctgga gaaagcagac attggagacg 301 cttacctttg gattggcgcg attgatgaat tcagtagtag tagtaataga gatttttatt 361 ggacatcttc tggaagaaaa atgaatttta cacattggat ggacggggaa ccatccacgt 421 cggatgaaca ctgcgtgata atgcatggaa cttgtcacaa ttttctatgg gatgatcgtg 481 gttgtactag taattggggt tttatttgcg aagaacgtta tttggatgtc ggctgcaaaa 541 aagactgcaa agaagagaaa aacgaagcta ttaagaaata ttcagaattg ttcatatctt 601 tacttgacga ttgttctgaa tttgaataac ggcgaaaaat aaactgctga atgaacttaa