Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013246170             660 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083258), mRNA.
ACCESSION   XM_013246170
VERSION     XM_013246170.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246170.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..660
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..660
                     /gene="LOC106083258"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106083258"
     CDS             45..629
                     /gene="LOC106083258"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013101624.2"
                     /db_xref="GeneID:106083258"
                     /translation="MDMTSLFKLEIVLLSGFLCGLAAAEPKWYTTSDGRRFLIDKEEK
                     YNWFQASHECGRRNLQLLEIDSNEKNVLLMEDVLEKADIGDAYLWIGAIDEFSSSSNR
                     DFYWTSSGRKMNFTHWMDGEPSTSDEHCVIMHGTCHNFLWDDRGCTSNWGFICEERYL
                     DVGCKKDCKEEKNEAIKKYSELFISLLDDCSEFE"
     polyA_site      660
                     /gene="LOC106083258"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttcaaatat caagtggcca gtctaaattg cagcttttta atcgatggac atgacgtctc
       61 tttttaagtt agaaattgtt ttattgagcg gctttctgtg tggcttggca gcggctgagc
      121 cgaaatggta caccacctct gatggaagac gatttttgat tgataaagag gaaaagtaca
      181 attggtttca agcttcgcac gaatgtgggc ggcgtaacct gcagttgctg gagatagact
      241 cgaatgaaaa gaatgtatta cttatggagg atgtgctgga gaaagcagac attggagacg
      301 cttacctttg gattggcgcg attgatgaat tcagtagtag tagtaataga gatttttatt
      361 ggacatcttc tggaagaaaa atgaatttta cacattggat ggacggggaa ccatccacgt
      421 cggatgaaca ctgcgtgata atgcatggaa cttgtcacaa ttttctatgg gatgatcgtg
      481 gttgtactag taattggggt tttatttgcg aagaacgtta tttggatgtc ggctgcaaaa
      541 aagactgcaa agaagagaaa aacgaagcta ttaagaaata ttcagaattg ttcatatctt
      601 tacttgacga ttgttctgaa tttgaataac ggcgaaaaat aaactgctga atgaacttaa