Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246168 577 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013246168 VERSION XM_013246168.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246168.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..577 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..577 /gene="LOC106083255" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106083255" CDS 26..517 /gene="LOC106083255" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_013101622.2" /db_xref="GeneID:106083255" /translation="MLFHTILLGSLLCGLAVAVPKWCNTTEKAYLVEEDQAYNWFQAL HECGRRNLQLVQIDSKEINDIIVNEVIRPNTVDYGAFFWLGGNDEFNVTSRERDFYWS PSGRKMDFSNWAEGQPDNDEYKEHCVHARGIWAYFRWNDYACDNRLGFICEEHSLAAV GKS" ORIGIN 1 aattatagtt tcaaaagtca gagacatgtt gtttcatact attttattag gctccctact 61 atgtggcttg gcagtggctg tgcctaaatg gtgcaacact accgaaaagg catatttggt 121 ggaagaggat caagcgtata actggttcca agcgttacac gaatgtggac ggcgtaacct 181 gcagttggtg caaatagatt cgaaggaaat caacgacatc attgtaaatg aagtgataag 241 gccaaataca gttgactacg gagctttctt ttggctaggc gggaatgatg aattcaacgt 301 aacaagcaga gaaagagact tctattggtc accttctggg agaaaaatgg atttctctaa 361 ctgggcagag ggtcaacctg acaatgacga atacaaagaa cattgcgtgc atgcacgtgg 421 aatatgggct tattttagat ggaatgatta tgcatgtgac aatcgtctcg gttttatatg 481 cgaagaacat agtttggctg ccgttggcaa gtcataaaat acaatgttta aaaataacaa 541 aaaaaaacca aatggattcg atacataaaa acaaaca