Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106083255),


LOCUS       XM_013246168             577 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013246168
VERSION     XM_013246168.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246168.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..577
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..577
                     /gene="LOC106083255"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106083255"
     CDS             26..517
                     /gene="LOC106083255"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013101622.2"
                     /db_xref="GeneID:106083255"
                     /translation="MLFHTILLGSLLCGLAVAVPKWCNTTEKAYLVEEDQAYNWFQAL
                     HECGRRNLQLVQIDSKEINDIIVNEVIRPNTVDYGAFFWLGGNDEFNVTSRERDFYWS
                     PSGRKMDFSNWAEGQPDNDEYKEHCVHARGIWAYFRWNDYACDNRLGFICEEHSLAAV
                     GKS"
ORIGIN      
        1 aattatagtt tcaaaagtca gagacatgtt gtttcatact attttattag gctccctact
       61 atgtggcttg gcagtggctg tgcctaaatg gtgcaacact accgaaaagg catatttggt
      121 ggaagaggat caagcgtata actggttcca agcgttacac gaatgtggac ggcgtaacct
      181 gcagttggtg caaatagatt cgaaggaaat caacgacatc attgtaaatg aagtgataag
      241 gccaaataca gttgactacg gagctttctt ttggctaggc gggaatgatg aattcaacgt
      301 aacaagcaga gaaagagact tctattggtc accttctggg agaaaaatgg atttctctaa
      361 ctgggcagag ggtcaacctg acaatgacga atacaaagaa cattgcgtgc atgcacgtgg
      421 aatatgggct tattttagat ggaatgatta tgcatgtgac aatcgtctcg gttttatatg
      481 cgaagaacat agtttggctg ccgttggcaa gtcataaaat acaatgttta aaaataacaa
      541 aaaaaaacca aatggattcg atacataaaa acaaaca