Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246161 940 bp mRNA linear INV 02-SEP-2023 (LOC106083249), mRNA. ACCESSION XM_013246161 VERSION XM_013246161.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246161.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..940 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..940 /gene="LOC106083249" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106083249" CDS 39..905 /gene="LOC106083249" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_013101615.2" /db_xref="GeneID:106083249" /translation="MGAFKIILCLALFGMVLAKPQWYTSKEGKKYFIEADQKYNWLAA SQACTRRNLQLAEIKSLDKNEDLVELLKSVFGHPINLWLGANDEFNTNKDLKRPFYWS SSGKRMDYTNWIEGGPANANSNEHCVHVCGKSKNFEWNDLPCTKKIGYICEEHRSDND HRNSMQEKSQKILDITKKLFESEQHEQKRSMEKITGIVSQVVKKNNEITHNLERIQQN MENGNSNRDVKFHNRELRSHVEAALQTVHDMDGELQKESENFYSKFSKKFSEAQKAIE HILGNKAKNVEK" ORIGIN 1 agaaattgtc agtttaattt gcaattatcg ttgacactat gggtgcattt aaaattattt 61 tgtgccttgc gttatttggc atggttttag ccaaacccca gtggtataca agcaaagaag 121 gcaaaaaata tttcattgag gctgatcaga agtacaactg gctagcagct agtcaagctt 181 gtaccagaag gaatttgcaa ttggcagaaa tcaaatcctt ggacaagaat gaagatctag 241 ttgaattgct caaatctgtt tttggccatc ccattaactt gtggctaggt gccaatgatg 301 agttcaacac caacaaggat cttaaacgcc ccttctattg gtcctcttct ggtaaacgca 361 tggattatac caattggatc gagggaggcc ctgccaatgc caactccaat gaacactgcg 421 tccatgtctg tggcaaatcg aaaaatttcg aatggaatga tttgccatgc accaagaaaa 481 tcggttacat ttgtgaagaa catcgttccg ataatgatca tcgtaattcg atgcaagaga 541 aaagtcaaaa aattttagat atcaccaaga aactctttga atctgagcaa catgagcaaa 601 aacgatccat ggaaaagatc actggcattg tcagtcaagt ggttaagaag aacaatgaga 661 tcacccataa tctggagaga attcaacaga atatggaaaa tggcaacagc aatcgcgatg 721 tgaaattcca caacagagaa ttgcgttctc atgtggaagc tgctttgcag acagtgcatg 781 atatggatgg ggagttgcaa aaggaatcgg aaaatttcta cagcaagttc tccaagaaat 841 ttagcgaagc tcaaaaagct attgaacata ttctgggaaa taaggcaaag aatgtagaaa 901 aatagttttt taaggcaggg gaacatgtct ttaaataaaa