Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013246161             940 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083249), mRNA.
ACCESSION   XM_013246161
VERSION     XM_013246161.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246161.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..940
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..940
                     /gene="LOC106083249"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106083249"
     CDS             39..905
                     /gene="LOC106083249"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013101615.2"
                     /db_xref="GeneID:106083249"
                     /translation="MGAFKIILCLALFGMVLAKPQWYTSKEGKKYFIEADQKYNWLAA
                     SQACTRRNLQLAEIKSLDKNEDLVELLKSVFGHPINLWLGANDEFNTNKDLKRPFYWS
                     SSGKRMDYTNWIEGGPANANSNEHCVHVCGKSKNFEWNDLPCTKKIGYICEEHRSDND
                     HRNSMQEKSQKILDITKKLFESEQHEQKRSMEKITGIVSQVVKKNNEITHNLERIQQN
                     MENGNSNRDVKFHNRELRSHVEAALQTVHDMDGELQKESENFYSKFSKKFSEAQKAIE
                     HILGNKAKNVEK"
ORIGIN      
        1 agaaattgtc agtttaattt gcaattatcg ttgacactat gggtgcattt aaaattattt
       61 tgtgccttgc gttatttggc atggttttag ccaaacccca gtggtataca agcaaagaag
      121 gcaaaaaata tttcattgag gctgatcaga agtacaactg gctagcagct agtcaagctt
      181 gtaccagaag gaatttgcaa ttggcagaaa tcaaatcctt ggacaagaat gaagatctag
      241 ttgaattgct caaatctgtt tttggccatc ccattaactt gtggctaggt gccaatgatg
      301 agttcaacac caacaaggat cttaaacgcc ccttctattg gtcctcttct ggtaaacgca
      361 tggattatac caattggatc gagggaggcc ctgccaatgc caactccaat gaacactgcg
      421 tccatgtctg tggcaaatcg aaaaatttcg aatggaatga tttgccatgc accaagaaaa
      481 tcggttacat ttgtgaagaa catcgttccg ataatgatca tcgtaattcg atgcaagaga
      541 aaagtcaaaa aattttagat atcaccaaga aactctttga atctgagcaa catgagcaaa
      601 aacgatccat ggaaaagatc actggcattg tcagtcaagt ggttaagaag aacaatgaga
      661 tcacccataa tctggagaga attcaacaga atatggaaaa tggcaacagc aatcgcgatg
      721 tgaaattcca caacagagaa ttgcgttctc atgtggaagc tgctttgcag acagtgcatg
      781 atatggatgg ggagttgcaa aaggaatcgg aaaatttcta cagcaagttc tccaagaaat
      841 ttagcgaagc tcaaaaagct attgaacata ttctgggaaa taaggcaaag aatgtagaaa
      901 aatagttttt taaggcaggg gaacatgtct ttaaataaaa