Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246160 1039 bp mRNA linear INV 02-SEP-2023 (LOC106083248), mRNA. ACCESSION XM_013246160 VERSION XM_013246160.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246160.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1039 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1039 /gene="LOC106083248" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106083248" CDS 67..969 /gene="LOC106083248" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_013101614.2" /db_xref="GeneID:106083248" /translation="MLDFKISLTFIFIGLTVAEPQWHNSSDGKHYLIEGEAKYNWFRA KHECSRRDLQLVEIHTETENQALVQLLRSIFGTSTSLWLGANDLFSPDMDTKRPFYWS SSGKPMTFSYWLQGEPNNERNQEHCVHTFAFEPDFKWNDVSCSNQYGFICEEKNAHVE YRSSLNEKRDAVLKAMKKFADSLQQEDEKLLDVVHHTRSLITKNNQDVEAFLKMLNSS NNKSDASHDSDASDNDKESQTGQENNKNNREEESQFSPETNQMISELNDELERSTEEV YKKLLQQFDEVQRAIEEGLKNDSE" polyA_site 1039 /gene="LOC106083248" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaatgttaaa aacctaaaat tgacttagtt catcaatttt tatttggaca tttgaccgac 61 gttactatgc tggattttaa gatttccctg acttttatat tcattggatt aacggtggca 121 gagccgcaat ggcataacag ttccgatggc aaacattatt tgatagaagg ggaagccaaa 181 tataattggt ttagggcaaa acatgagtgc tctcgcagag atttgcaatt ggtggaaatt 241 catactgaaa ccgaaaatca agctttggtg cagcttttga gatcgatctt tggtacctcc 301 accagccttt ggctgggggc caacgatctc ttcagtcccg atatggatac caagcgtcct 361 ttctattggt cttcgtcagg caaacccatg accttcagct attggcttca aggtgaaccc 421 aacaatgaac gcaatcaaga acactgtgtc catacatttg cctttgaacc tgatttcaaa 481 tggaatgatg tctcctgctc caatcagtat ggcttcatat gcgaagagaa aaatgcccat 541 gtcgagtatc gttcgtcttt aaatgaaaaa cgtgacgctg ttctaaaggc catgaaaaaa 601 ttcgccgact cattgcaaca agaggatgaa aaacttcttg acgttgtaca ccatactcga 661 agtctaatta caaagaacaa ccaagatgtt gaggcattct tgaaaatgtt aaacagcagc 721 aacaacaaat cagacgcctc ccatgattcg gatgccagcg ataatgacaa agagtcccaa 781 accggccaag agaataacaa gaataaccgt gaggaagaaa gtcaatttag ccccgaaaca 841 aatcaaatga tttccgagct caatgacgaa ttagagcgtt ccaccgaaga agtctataag 901 aaattattgc aacaatttga tgaagttcag agggcaattg aagagggcct taaaaatgat 961 tcagagtaat taaatagaaa atcttaaaat aagacatttg acatggcaaa accgatttaa 1021 taaattacaa ataatttta