Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013246160            1039 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083248), mRNA.
ACCESSION   XM_013246160
VERSION     XM_013246160.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246160.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1039
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1039
                     /gene="LOC106083248"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106083248"
     CDS             67..969
                     /gene="LOC106083248"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013101614.2"
                     /db_xref="GeneID:106083248"
                     /translation="MLDFKISLTFIFIGLTVAEPQWHNSSDGKHYLIEGEAKYNWFRA
                     KHECSRRDLQLVEIHTETENQALVQLLRSIFGTSTSLWLGANDLFSPDMDTKRPFYWS
                     SSGKPMTFSYWLQGEPNNERNQEHCVHTFAFEPDFKWNDVSCSNQYGFICEEKNAHVE
                     YRSSLNEKRDAVLKAMKKFADSLQQEDEKLLDVVHHTRSLITKNNQDVEAFLKMLNSS
                     NNKSDASHDSDASDNDKESQTGQENNKNNREEESQFSPETNQMISELNDELERSTEEV
                     YKKLLQQFDEVQRAIEEGLKNDSE"
     polyA_site      1039
                     /gene="LOC106083248"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaatgttaaa aacctaaaat tgacttagtt catcaatttt tatttggaca tttgaccgac
       61 gttactatgc tggattttaa gatttccctg acttttatat tcattggatt aacggtggca
      121 gagccgcaat ggcataacag ttccgatggc aaacattatt tgatagaagg ggaagccaaa
      181 tataattggt ttagggcaaa acatgagtgc tctcgcagag atttgcaatt ggtggaaatt
      241 catactgaaa ccgaaaatca agctttggtg cagcttttga gatcgatctt tggtacctcc
      301 accagccttt ggctgggggc caacgatctc ttcagtcccg atatggatac caagcgtcct
      361 ttctattggt cttcgtcagg caaacccatg accttcagct attggcttca aggtgaaccc
      421 aacaatgaac gcaatcaaga acactgtgtc catacatttg cctttgaacc tgatttcaaa
      481 tggaatgatg tctcctgctc caatcagtat ggcttcatat gcgaagagaa aaatgcccat
      541 gtcgagtatc gttcgtcttt aaatgaaaaa cgtgacgctg ttctaaaggc catgaaaaaa
      601 ttcgccgact cattgcaaca agaggatgaa aaacttcttg acgttgtaca ccatactcga
      661 agtctaatta caaagaacaa ccaagatgtt gaggcattct tgaaaatgtt aaacagcagc
      721 aacaacaaat cagacgcctc ccatgattcg gatgccagcg ataatgacaa agagtcccaa
      781 accggccaag agaataacaa gaataaccgt gaggaagaaa gtcaatttag ccccgaaaca
      841 aatcaaatga tttccgagct caatgacgaa ttagagcgtt ccaccgaaga agtctataag
      901 aaattattgc aacaatttga tgaagttcag agggcaattg aagagggcct taaaaatgat
      961 tcagagtaat taaatagaaa atcttaaaat aagacatttg acatggcaaa accgatttaa
     1021 taaattacaa ataatttta