Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246145 976 bp mRNA linear INV 02-SEP-2023 (LOC106083235), mRNA. ACCESSION XM_013246145 VERSION XM_013246145.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246145.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..976 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..976 /gene="LOC106083235" /note="uncharacterized LOC106083235; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106083235" CDS 70..894 /gene="LOC106083235" /codon_start=1 /product="uncharacterized protein LOC106083235" /protein_id="XP_013101599.2" /db_xref="GeneID:106083235" /translation="MPTNFDSCFERLCERPLQCRFPPCNCEKCQERWIDNDETDSEEE DGGGCWNLSTETESEEFHCRDNKPRICLPTNIYAALCDIFGVIAFIIMTSVTLWLMVW HYMWRFGVYIYRSGRKTQYIALALLSMLFLCIVFHSIGGCTMKTQHKEKIKTSCVCND VKGNEPKTTPTNEKQRQRGGANEMQHSHGTHTKLDPEHIKEECKKKKSSDSLCALCGK FHKDSLVKSKTEMSDHEVRRIFEKFKLYSMPSEWKSPPAIIVLLKDYLVDFFGGWQ" polyA_site 976 /gene="LOC106083235" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcctggctga aacttacttt tcttgtcacc atttcaataa taaaaattct aaatattttt 61 tgtacaatta tgcccacaaa ttttgactct tgtttcgaac gactatgtga acggccactt 121 caatgtagat ttcctccatg taactgtgaa aaatgtcaag aacgatggat tgataatgat 181 gaaactgata gtgaagagga agatggtggt ggttgttgga atctctcaac ggaaacagaa 241 tccgaagaat ttcattgtag agataataaa cctcgaattt gtcttccaac caacatttat 301 gcagcactat gtgacatatt tggagttata gctttcatca ttatgacttc agttactctt 361 tggttaatgg tctggcatta tatgtggcgt tttggagtct atatctatcg ttctggaaga 421 aaaactcaat atattgctct agctcttttg tcaatgcttt tcctctgcat cgtttttcat 481 tcaattggtg gatgcaccat gaaaacccaa cataaagaaa aaattaaaac atcatgtgtt 541 tgtaacgatg ttaaagggaa tgaacctaaa actacaccca caaatgaaaa acaacgacaa 601 agagggggag caaatgaaat gcaacattca catggcactc acacaaaatt ggatcccgaa 661 cacataaagg aggagtgtaa gaagaaaaaa tcaagtgatt cattgtgtgc actatgcggg 721 aaatttcata aagattctct ggtcaagtct aagacagaaa tgagtgatca tgaggttcgc 781 agaattttcg aaaaatttaa attgtactcc atgcccagtg aatggaaatc gccgccagcc 841 attattgttt tactcaagga ctatttggtg gatttttttg gtggttggca atagactaat 901 ttgtaatcaa aattatataa aacttggctc tatttatgga tatataaaaa cagtttaaat 961 attgtatcaa aaagtt