Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106083235


LOCUS       XM_013246145             976 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083235), mRNA.
ACCESSION   XM_013246145
VERSION     XM_013246145.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246145.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..976
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..976
                     /gene="LOC106083235"
                     /note="uncharacterized LOC106083235; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106083235"
     CDS             70..894
                     /gene="LOC106083235"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083235"
                     /protein_id="XP_013101599.2"
                     /db_xref="GeneID:106083235"
                     /translation="MPTNFDSCFERLCERPLQCRFPPCNCEKCQERWIDNDETDSEEE
                     DGGGCWNLSTETESEEFHCRDNKPRICLPTNIYAALCDIFGVIAFIIMTSVTLWLMVW
                     HYMWRFGVYIYRSGRKTQYIALALLSMLFLCIVFHSIGGCTMKTQHKEKIKTSCVCND
                     VKGNEPKTTPTNEKQRQRGGANEMQHSHGTHTKLDPEHIKEECKKKKSSDSLCALCGK
                     FHKDSLVKSKTEMSDHEVRRIFEKFKLYSMPSEWKSPPAIIVLLKDYLVDFFGGWQ"
     polyA_site      976
                     /gene="LOC106083235"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcctggctga aacttacttt tcttgtcacc atttcaataa taaaaattct aaatattttt
       61 tgtacaatta tgcccacaaa ttttgactct tgtttcgaac gactatgtga acggccactt
      121 caatgtagat ttcctccatg taactgtgaa aaatgtcaag aacgatggat tgataatgat
      181 gaaactgata gtgaagagga agatggtggt ggttgttgga atctctcaac ggaaacagaa
      241 tccgaagaat ttcattgtag agataataaa cctcgaattt gtcttccaac caacatttat
      301 gcagcactat gtgacatatt tggagttata gctttcatca ttatgacttc agttactctt
      361 tggttaatgg tctggcatta tatgtggcgt tttggagtct atatctatcg ttctggaaga
      421 aaaactcaat atattgctct agctcttttg tcaatgcttt tcctctgcat cgtttttcat
      481 tcaattggtg gatgcaccat gaaaacccaa cataaagaaa aaattaaaac atcatgtgtt
      541 tgtaacgatg ttaaagggaa tgaacctaaa actacaccca caaatgaaaa acaacgacaa
      601 agagggggag caaatgaaat gcaacattca catggcactc acacaaaatt ggatcccgaa
      661 cacataaagg aggagtgtaa gaagaaaaaa tcaagtgatt cattgtgtgc actatgcggg
      721 aaatttcata aagattctct ggtcaagtct aagacagaaa tgagtgatca tgaggttcgc
      781 agaattttcg aaaaatttaa attgtactcc atgcccagtg aatggaaatc gccgccagcc
      841 attattgttt tactcaagga ctatttggtg gatttttttg gtggttggca atagactaat
      901 ttgtaatcaa aattatataa aacttggctc tatttatgga tatataaaaa cagtttaaat
      961 attgtatcaa aaagtt