Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans proton-coupled amino acid


LOCUS       XM_013246141            1738 bp    mRNA    linear   INV 02-SEP-2023
            transporter 1 (LOC106083234), transcript variant X1, mRNA.
ACCESSION   XM_013246141
VERSION     XM_013246141.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246141.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1738
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1738
                     /gene="LOC106083234"
                     /note="proton-coupled amino acid transporter 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 9 Proteins"
                     /db_xref="GeneID:106083234"
     CDS             133..1635
                     /gene="LOC106083234"
                     /codon_start=1
                     /product="proton-coupled amino acid transporter 1 isoform
                     X1"
                     /protein_id="XP_013101595.2"
                     /db_xref="GeneID:106083234"
                     /translation="MSKSLKIIDNGLLINCRNKNQYSLSDYEEISSFDSKSALLNSEM
                     FFANKKKPPAPITRIPEAPNVDDHIKKEIPTSYFQSFIHLLKGNIGPGLFAMGFAFMH
                     GGLLVAPILTVLIALVSIHCQHMLINSSIKMKTLRNAEKYPDFAETIEQCFEMGPTAT
                     QRLSRTMKMLVNLFICVTQLGFCCIYFVFISTNVKQILLAYDIHLDVHYVMLITFVPI
                     WLSSMITNLKYLTPVSFIANICMICGLSITMYYGLKDGLPEIGDRKLYTTPMDLALYF
                     GTAIFAFEGIALVLPLKNAMANPHNFDRPMGVLNVGMFFVTLMFMTAGFVGYSKWGDD
                     VAGSLTLNLGDTIGAQIVKAMVSMGVLFGYPLQFHIAIQIMLPTVIETFKCYNHSLAA
                     NLTFRTFMVVVTLGIAELVPNLGLFISLIGSLCSTALALVFPPIIELIVKRDISSTCS
                     RYMMYLKNTIILVLAFAGFLAGTYESLSEIIKEFGSEVKTTDSVLVDSNS"
     polyA_site      1738
                     /gene="LOC106083234"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttagaaagtt tctaatcagc cattgtggtg aacggacgtg tgtgtggaat gtgaaaaaaa
       61 aactttggaa atattcaaac acggaataaa actttttgtt gcaattctta aggatagaaa
      121 aaaatcttaa aaatgtccaa atcattaaaa atcatagaca atggtctatt aataaattgc
      181 agaaataaaa atcaatactc cttgtcggat tatgaagaga tatcgtcctt tgacagcaag
      241 agtgctttgt tgaacagtga aatgtttttt gcaaataaga aaaaaccccc agctcccata
      301 acacggatac cggaagctcc caatgtcgat gatcacatta aaaaggaaat acccaccagc
      361 tactttcagt cttttattca tctgctcaag ggcaacattg gccctggact ctttgccatg
      421 ggctttgcct ttatgcatgg cggtctgctg gtggcaccca tactcaccgt actcatagcc
      481 ttggtgtcca tacactgtca acacatgctg ataaattcct ccattaaaat gaagactcta
      541 agaaatgcag aaaaatatcc tgattttgct gagaccattg aacagtgttt tgaaatgggt
      601 cccacggcca cacagagatt gtcgaggacc atgaaaatgc tggtgaatct attcatttgt
      661 gtgacacaat tgggtttctg ttgtatctat tttgtgttta tcagcacgaa tgtgaaacag
      721 attttgcttg cctatgacat acacctagat gtccattatg ttatgcttat tacctttgtt
      781 cccatttggc ttagttccat gataaccaat ctcaagtatt tgacccctgt atcgtttata
      841 gccaatattt gcatgatatg cggtctaagc atcaccatgt attatggcct taaggatggc
      901 ctgcccgaaa tcggagatcg caaactctac accacaccca tggacttggc cttgtatttt
      961 ggtactgcaa tttttgcctt tgagggcatt gccttggttt tgcctttgaa gaatgccatg
     1021 gcaaatccac ataatttcga taggcccatg ggagtgctga atgtgggcat gttttttgtc
     1081 accctaatgt ttatgacagc tggtttcgtt ggctacagca aatggggaga tgatgtagct
     1141 ggaagtttaa cccttaatct gggagataca ataggtgcac aaattgtgaa ggcaatggta
     1201 tcgatgggag tattattcgg ttatcctcta caattccata tagccataca gataatgtta
     1261 ccaactgtga tagagacatt caaatgttac aatcattcat tggcggctaa tttaacattc
     1321 aggacattta tggtggtggt aacattgggc attgctgagc tggttcccaa tttgggtctg
     1381 ttcatctcac tcattggctc gctgtgttcc accgctttgg ccctggtctt tccccccatc
     1441 attgagctga ttgtgaaacg tgatatttcg agtacctgct ctagatatat gatgtatcta
     1501 aagaatacca ttatactagt attggccttt gctggctttc tggccggcac ctatgaaagt
     1561 ctttcggaga taatcaaaga atttggttcg gaggtgaaaa caaccgactc agttctggtg
     1621 gattcgaatt catgaaaata tcccaaaata gaccataatc acatatccac aacaataaaa
     1681 aaacaaaaaa cgagagagac atcatcaact taaataaaat aattcaaata ttttgtta