Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans general odorant-binding protein 28a


LOCUS       XM_013246120             662 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083227), mRNA.
ACCESSION   XM_013246120
VERSION     XM_013246120.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246120.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..662
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..662
                     /gene="LOC106083227"
                     /note="general odorant-binding protein 28a; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 11 Proteins"
                     /db_xref="GeneID:106083227"
     CDS             16..549
                     /gene="LOC106083227"
                     /codon_start=1
                     /product="general odorant-binding protein 28a"
                     /protein_id="XP_013101574.1"
                     /db_xref="GeneID:106083227"
                     /translation="MHFVKYPLLAEGGSILIKTKIESDIILNKMTKYLVTLAILCVFG
                     AVIVRGEIDKKAMIADFMAKAEVCKGETGGKDADIADMVARKPASTPEGKCMRSCLMK
                     KYGAMNGDGKLDKVVAREHAEMYTEGDPAKMTIADEVVAACDALAVSGDHCEAAEEYL
                     KCFKEQAKAHGIEDIDF"
     misc_feature    175..513
                     /gene="LOC106083227"
                     /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395"
                     /db_xref="CDD:460193"
     misc_feature    order(196..198,304..306,316..318,334..336,481..483,
                     502..504)
                     /gene="LOC106083227"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:467938"
     polyA_site      662
                     /gene="LOC106083227"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tagtggcgag ttgaaatgca ctttgttaag tatccattgt tagctgaagg tggaagcatt
       61 ctaattaaaa ctaaaataga aagtgatata attctcaaca aaatgacaaa atacttagtg
      121 acactagcaa ttttgtgtgt tttcggggcc gtcatagttc gtggagaaat cgataagaaa
      181 gctatgattg ctgattttat ggctaaagct gaagtgtgta aaggcgagac cggtggcaag
      241 gatgctgata ttgccgatat ggtagctaga aaacccgctt caactcccga aggcaagtgt
      301 atgcgatcgt gccttatgaa aaaatatgga gcgatgaacg gcgatggtaa actagataaa
      361 gtcgttgcca gagaacatgc tgaaatgtat actgaaggtg atcctgcaaa gatgacaata
      421 gctgatgaag ttgtcgcagc ttgcgatgca ctggcagtat ctggagacca ctgtgaagct
      481 gcagaggaat atctgaaatg ttttaaggag caggctaaag cccatggaat tgaagacatt
      541 gacttctaaa agctatcgga ccaatgctgt tatggaccaa aatatacaca cgttatgctt
      601 taatcttaag tttagttatt aaataaataa tgattatatg attatagctt gcaatatcaa
      661 aa