Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246120 662 bp mRNA linear INV 02-SEP-2023 (LOC106083227), mRNA. ACCESSION XM_013246120 VERSION XM_013246120.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246120.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..662 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..662 /gene="LOC106083227" /note="general odorant-binding protein 28a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106083227" CDS 16..549 /gene="LOC106083227" /codon_start=1 /product="general odorant-binding protein 28a" /protein_id="XP_013101574.1" /db_xref="GeneID:106083227" /translation="MHFVKYPLLAEGGSILIKTKIESDIILNKMTKYLVTLAILCVFG AVIVRGEIDKKAMIADFMAKAEVCKGETGGKDADIADMVARKPASTPEGKCMRSCLMK KYGAMNGDGKLDKVVAREHAEMYTEGDPAKMTIADEVVAACDALAVSGDHCEAAEEYL KCFKEQAKAHGIEDIDF" misc_feature 175..513 /gene="LOC106083227" /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395" /db_xref="CDD:460193" misc_feature order(196..198,304..306,316..318,334..336,481..483, 502..504) /gene="LOC106083227" /note="ligand binding site [chemical binding]; other site" /db_xref="CDD:467938" polyA_site 662 /gene="LOC106083227" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tagtggcgag ttgaaatgca ctttgttaag tatccattgt tagctgaagg tggaagcatt 61 ctaattaaaa ctaaaataga aagtgatata attctcaaca aaatgacaaa atacttagtg 121 acactagcaa ttttgtgtgt tttcggggcc gtcatagttc gtggagaaat cgataagaaa 181 gctatgattg ctgattttat ggctaaagct gaagtgtgta aaggcgagac cggtggcaag 241 gatgctgata ttgccgatat ggtagctaga aaacccgctt caactcccga aggcaagtgt 301 atgcgatcgt gccttatgaa aaaatatgga gcgatgaacg gcgatggtaa actagataaa 361 gtcgttgcca gagaacatgc tgaaatgtat actgaaggtg atcctgcaaa gatgacaata 421 gctgatgaag ttgtcgcagc ttgcgatgca ctggcagtat ctggagacca ctgtgaagct 481 gcagaggaat atctgaaatg ttttaaggag caggctaaag cccatggaat tgaagacatt 541 gacttctaaa agctatcgga ccaatgctgt tatggaccaa aatatacaca cgttatgctt 601 taatcttaag tttagttatt aaataaataa tgattatatg attatagctt gcaatatcaa 661 aa