Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013246113             614 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083223), mRNA.
ACCESSION   XM_013246113
VERSION     XM_013246113.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246113.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..614
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..614
                     /gene="LOC106083223"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106083223"
     CDS             41..592
                     /gene="LOC106083223"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013101567.1"
                     /db_xref="GeneID:106083223"
                     /translation="MSKTLLIIRILILHQITWWQLVDGVPVEKWFELQPNHRVFIERD
                     YRYNWFQARNECLLKNMSLITVDTSEKSAALTSLLKRIFDKPHNLWLGGDDLGQENVF
                     VWSSSGKRFEFTNWSHGNPSHNRGQEHCVNLWDATDFEWNDAPCNELKGFICEDNVFM
                     LAARKEVERMKKVLLEIHDECSE"
     misc_feature    170..505
                     /gene="LOC106083223"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(422..424,434..436,440..442,458..460,464..475,
                     482..490)
                     /gene="LOC106083223"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     polyA_site      614
                     /gene="LOC106083223"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttagcatca ttttgaaata aacaactcaa cagtttgata atgagtaaga cattgctgat
       61 aatacgaatt ttaatactac atcaaataac atggtggcag cttgttgatg gagtaccagt
      121 ggaaaaatgg tttgaactcc aacccaatca tagggtcttt atagaaagag attacaggta
      181 caattggttc caagcccgca atgaatgtct actgaaaaat atgtccctta taacggtaga
      241 tacctcggag aaaagtgctg ctttaacctc tctgctgaaa aggatttttg ataaacccca
      301 taatttatgg ctgggtggcg atgatttggg ccaagaaaat gtttttgttt ggtcctcgtc
      361 tggtaaacgt tttgagttca ccaattggag tcatggaaat cccagccata atcgtggtca
      421 agagcattgc gttaatcttt gggatgccac cgattttgaa tggaatgatg caccctgtaa
      481 tgaactgaag ggatttattt gtgaagacaa tgtttttatg ttggcagctc gcaaagaagt
      541 ggagagaatg aagaaagttt tattggagat tcatgatgaa tgtagtgaat aaagagaaaa
      601 ttatatgcat taga