Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246113 614 bp mRNA linear INV 02-SEP-2023 (LOC106083223), mRNA. ACCESSION XM_013246113 VERSION XM_013246113.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246113.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..614 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..614 /gene="LOC106083223" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106083223" CDS 41..592 /gene="LOC106083223" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_013101567.1" /db_xref="GeneID:106083223" /translation="MSKTLLIIRILILHQITWWQLVDGVPVEKWFELQPNHRVFIERD YRYNWFQARNECLLKNMSLITVDTSEKSAALTSLLKRIFDKPHNLWLGGDDLGQENVF VWSSSGKRFEFTNWSHGNPSHNRGQEHCVNLWDATDFEWNDAPCNELKGFICEDNVFM LAARKEVERMKKVLLEIHDECSE" misc_feature 170..505 /gene="LOC106083223" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(422..424,434..436,440..442,458..460,464..475, 482..490) /gene="LOC106083223" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" polyA_site 614 /gene="LOC106083223" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttagcatca ttttgaaata aacaactcaa cagtttgata atgagtaaga cattgctgat 61 aatacgaatt ttaatactac atcaaataac atggtggcag cttgttgatg gagtaccagt 121 ggaaaaatgg tttgaactcc aacccaatca tagggtcttt atagaaagag attacaggta 181 caattggttc caagcccgca atgaatgtct actgaaaaat atgtccctta taacggtaga 241 tacctcggag aaaagtgctg ctttaacctc tctgctgaaa aggatttttg ataaacccca 301 taatttatgg ctgggtggcg atgatttggg ccaagaaaat gtttttgttt ggtcctcgtc 361 tggtaaacgt tttgagttca ccaattggag tcatggaaat cccagccata atcgtggtca 421 agagcattgc gttaatcttt gggatgccac cgattttgaa tggaatgatg caccctgtaa 481 tgaactgaag ggatttattt gtgaagacaa tgtttttatg ttggcagctc gcaaagaagt 541 ggagagaatg aagaaagttt tattggagat tcatgatgaa tgtagtgaat aaagagaaaa 601 ttatatgcat taga