Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246112 643 bp mRNA linear INV 02-SEP-2023 (LOC106083222), mRNA. ACCESSION XM_013246112 VERSION XM_013246112.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246112.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..643 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..643 /gene="LOC106083222" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106083222" CDS 33..569 /gene="LOC106083222" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_013101566.2" /db_xref="GeneID:106083222" /translation="MTVFTNTLVILSVLLTIGHLVQAVAKNKVYELEGVGTIYVETDQ KYNWFEAWDECAIQNMSLIAVYSPEKSAALTQILRDNSVKVNLWLGGNDLGEEGRFVW ASSGKKFAFSNWSKGNPDNHNNGDCINIWDVTDFEWNDAACNYTIGFICEEHPLLVAA RKDLEVKKNFIEQVLAMH" polyA_site 643 /gene="LOC106083222" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aatttgcccc attcaacatt tgacaatcaa acatgacagt ctttacgaac accttggtaa 61 tactatcagt tctactaaca attggtcatt tggtccaggc agtggcaaag aataaagttt 121 atgagctaga aggggtggga accatctatg tggaaaccga tcagaagtac aattggtttg 181 aggcttggga tgaatgtgcc attcaaaata tgtctctgat agccgtgtat tcgcctgaga 241 aaagtgccgc attgacacaa attctaagag acaactcagt taaggtcaat ttatggctgg 301 gtggcaatga tttaggcgaa gagggtcgat tcgtttgggc ttctagtggc aaaaaatttg 361 cctttagcaa ttggagcaaa ggcaatcccg ataatcataa taatggcgat tgcatcaata 421 tctgggatgt caccgatttc gaatggaacg atgctgcctg caactatacc atcggcttta 481 tatgcgaaga gcatccgtta ttggtagcag cacgcaagga tttggaggtg aagaaaaatt 541 tcatcgaaca ggtgttggca atgcattgag atgaaagtaa aggaaatgga ctcaaacttt 601 tttataaaaa ttaaattttc gggaaatgtt tctcccatac gta