Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013246112             643 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083222), mRNA.
ACCESSION   XM_013246112
VERSION     XM_013246112.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246112.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..643
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..643
                     /gene="LOC106083222"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106083222"
     CDS             33..569
                     /gene="LOC106083222"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013101566.2"
                     /db_xref="GeneID:106083222"
                     /translation="MTVFTNTLVILSVLLTIGHLVQAVAKNKVYELEGVGTIYVETDQ
                     KYNWFEAWDECAIQNMSLIAVYSPEKSAALTQILRDNSVKVNLWLGGNDLGEEGRFVW
                     ASSGKKFAFSNWSKGNPDNHNNGDCINIWDVTDFEWNDAACNYTIGFICEEHPLLVAA
                     RKDLEVKKNFIEQVLAMH"
     polyA_site      643
                     /gene="LOC106083222"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aatttgcccc attcaacatt tgacaatcaa acatgacagt ctttacgaac accttggtaa
       61 tactatcagt tctactaaca attggtcatt tggtccaggc agtggcaaag aataaagttt
      121 atgagctaga aggggtggga accatctatg tggaaaccga tcagaagtac aattggtttg
      181 aggcttggga tgaatgtgcc attcaaaata tgtctctgat agccgtgtat tcgcctgaga
      241 aaagtgccgc attgacacaa attctaagag acaactcagt taaggtcaat ttatggctgg
      301 gtggcaatga tttaggcgaa gagggtcgat tcgtttgggc ttctagtggc aaaaaatttg
      361 cctttagcaa ttggagcaaa ggcaatcccg ataatcataa taatggcgat tgcatcaata
      421 tctgggatgt caccgatttc gaatggaacg atgctgcctg caactatacc atcggcttta
      481 tatgcgaaga gcatccgtta ttggtagcag cacgcaagga tttggaggtg aagaaaaatt
      541 tcatcgaaca ggtgttggca atgcattgag atgaaagtaa aggaaatgga ctcaaacttt
      601 tttataaaaa ttaaattttc gggaaatgtt tctcccatac gta