Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106083221),


LOCUS       XM_013246111             597 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013246111
VERSION     XM_013246111.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246111.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..597
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..597
                     /gene="LOC106083221"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106083221"
     CDS             37..570
                     /gene="LOC106083221"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013101565.2"
                     /db_xref="GeneID:106083221"
                     /translation="MFFALFKTTILILVAAQVTHAVVYDKWHGMEEFGKIFIEEEQKY
                     NWFEAWNECAIRNMTLIAVDTVEKNAALDGILRKKFAKCPNLWIGGNDLGEEGKFIWT
                     PTGKRFEFSNWQKGQPDNYKSNNHCVHYYNIADFEWNDAPCSSKIGFICEENHFLRLA
                     RRDLDIKKNFIDQLFAL"
     polyA_site      597
                     /gene="LOC106083221"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cattgacttc attcgtttcc aatcaatcgt ttaaaaatgt tctttgcttt atttaaaact
       61 acaattttaa ttttggtggc tgcgcaagtt actcatgcag tggtttacga taaatggcat
      121 ggcatggagg aatttggtaa aatttttata gaagaagaac aaaagtacaa ttggtttgag
      181 gcgtggaacg aatgtgccat aagaaatatg accttaattg ccgtggacac agtggagaaa
      241 aatgccgcat tggatggcat actacgaaaa aaatttgcta aatgtcccaa tttatggatt
      301 ggcggcaatg atcttggcga agagggcaaa ttcatttgga ctccaacagg caaacgtttt
      361 gaattctcca attggcaaaa gggacaaccg gataactaca aaagcaataa ccactgtgtc
      421 cactactata acattgcaga ttttgagtgg aacgatgccc catgttcttc gaaaattggt
      481 ttcatctgtg aagagaatca tttcttgagg ttggctcgaa gagatctgga tattaagaaa
      541 aattttatag atcaattgtt tgcactgtaa aatacttata aatatataaa aaaaatt