Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246110 663 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013246110 VERSION XM_013246110.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246110.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..663 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..663 /gene="LOC106083220" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106083220" CDS 41..577 /gene="LOC106083220" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_013101564.2" /db_xref="GeneID:106083220" /translation="MEKNLVNISLLIIQILIIDIVYGIPVKKWYDLKNVGNIFIENDQ KFNWFQAWNECVSQNMVLITVDTWEKNEDLTQLLRENSLKSNLWIGGHDWGDKGRFVW SSTGKRFTFTNWSKGNPDNVRDVGSCVHYWKSADYEWNDAQFNNTFGFICEENPRLVT ARKDLEMKKEFMDRLFEL" polyA_site 663 /gene="LOC106083220" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gctcttgtat tcgacatttc aagtgaaacc agagtagagt atggagaaga atctcgttaa 61 tatttcatta ctgatcatac aaatattgat catagatatt gtttatggta ttccggtgaa 121 aaaatggtat gatttgaaaa atgttggcaa cattttcata gaaaatgatc aaaagttcaa 181 ttggtttcaa gcttggaatg aatgtgtctc ccagaatatg gtattaataa ctgtggatac 241 gtgggagaaa aatgaggacc taacccagct tttgagagag aactcattaa aatccaattt 301 atggattggt ggccatgact ggggtgacaa aggtcgtttt gtatggtcct ccaccggcaa 361 acgtttcacc tttaccaact ggagcaaagg caatcccgat aatgtccgag atgtgggcag 421 ctgtgtccat tattggaaat cagccgacta tgagtggaac gatgcccaat ttaataatac 481 ctttggtttt atatgcgaag agaatccccg acttgtgaca gctcgcaaag atcttgagat 541 gaaaaaggaa tttatggatc gtttatttga gctataggtt gaccttagtg taaaaaaagg 601 tttcgctgcc gaatctccat gactccactt acaagaaata aataatatat aatttttctt 661 aaa