Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106083220),


LOCUS       XM_013246110             663 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013246110
VERSION     XM_013246110.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246110.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..663
                     /gene="LOC106083220"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106083220"
     CDS             41..577
                     /gene="LOC106083220"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013101564.2"
                     /db_xref="GeneID:106083220"
                     /translation="MEKNLVNISLLIIQILIIDIVYGIPVKKWYDLKNVGNIFIENDQ
                     KFNWFQAWNECVSQNMVLITVDTWEKNEDLTQLLRENSLKSNLWIGGHDWGDKGRFVW
                     SSTGKRFTFTNWSKGNPDNVRDVGSCVHYWKSADYEWNDAQFNNTFGFICEENPRLVT
                     ARKDLEMKKEFMDRLFEL"
     polyA_site      663
                     /gene="LOC106083220"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gctcttgtat tcgacatttc aagtgaaacc agagtagagt atggagaaga atctcgttaa
       61 tatttcatta ctgatcatac aaatattgat catagatatt gtttatggta ttccggtgaa
      121 aaaatggtat gatttgaaaa atgttggcaa cattttcata gaaaatgatc aaaagttcaa
      181 ttggtttcaa gcttggaatg aatgtgtctc ccagaatatg gtattaataa ctgtggatac
      241 gtgggagaaa aatgaggacc taacccagct tttgagagag aactcattaa aatccaattt
      301 atggattggt ggccatgact ggggtgacaa aggtcgtttt gtatggtcct ccaccggcaa
      361 acgtttcacc tttaccaact ggagcaaagg caatcccgat aatgtccgag atgtgggcag
      421 ctgtgtccat tattggaaat cagccgacta tgagtggaac gatgcccaat ttaataatac
      481 ctttggtttt atatgcgaag agaatccccg acttgtgaca gctcgcaaag atcttgagat
      541 gaaaaaggaa tttatggatc gtttatttga gctataggtt gaccttagtg taaaaaaagg
      601 tttcgctgcc gaatctccat gactccactt acaagaaata aataatatat aatttttctt
      661 aaa