Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246109 606 bp mRNA linear INV 02-SEP-2023 C1D (LOC106083219), mRNA. ACCESSION XM_013246109 VERSION XM_013246109.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246109.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..606 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..606 /gene="LOC106083219" /note="nuclear nucleic acid-binding protein C1D; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106083219" CDS 102..551 /gene="LOC106083219" /codon_start=1 /product="nuclear nucleic acid-binding protein C1D" /protein_id="XP_013101563.1" /db_xref="GeneID:106083219" /translation="MTSGARDYGELRNDEKFINCVENFDESLDKIEASIQTAIGFKDY EELSTQERVKLDNYLAYSINSLYWMYVKLQGLDPNEHGIKNELSRTRQTILRDKEIYE RNTIRPKLDKGAAGRFIKHGLHLRYDKEGNPINDKGEHSNRDEPMEN" misc_feature 144..389 /gene="LOC106083219" /note="Sas10/Utp3/C1D family; Region: Sas10_Utp3; pfam04000" /db_xref="CDD:461123" polyA_site 606 /gene="LOC106083219" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgttttcaa acaaattttg cttttgacgt tttaactaag tgcaagccat ttaaagtatt 61 tatatcatca attagaattt tgaaaagaaa tcctactcaa aatgacttca ggtgcccgag 121 attatggaga actacgaaat gatgaaaagt tcatcaattg cgtggaaaac ttcgatgaaa 181 gtttggataa aattgaggct tcaatacaaa cagcaattgg ttttaaggac tatgaagagt 241 tatctacaca ggaacgggtt aaactggaca attatttggc atattcgatt aactcacttt 301 actggatgta tgtcaagcta caaggattgg atcctaatga gcatggcatt aaaaatgaac 361 tgtcccgtac tcgacaaacg atattgagag ataaggaaat ctatgaacgt aacaccatac 421 gtcccaaact agacaaagga gcagctggtc gttttattaa gcatggttta catctacgat 481 atgacaaaga aggcaatccc ataaatgaca aaggagaaca tagtaataga gatgaaccaa 541 tggaaaatta gttgtaaata gacctcattt gaattttcat actttaaaaa gagattcagc 601 cgttta