Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans nuclear nucleic acid-binding protein


LOCUS       XM_013246109             606 bp    mRNA    linear   INV 02-SEP-2023
            C1D (LOC106083219), mRNA.
ACCESSION   XM_013246109
VERSION     XM_013246109.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246109.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..606
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..606
                     /gene="LOC106083219"
                     /note="nuclear nucleic acid-binding protein C1D; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 7 Proteins"
                     /db_xref="GeneID:106083219"
     CDS             102..551
                     /gene="LOC106083219"
                     /codon_start=1
                     /product="nuclear nucleic acid-binding protein C1D"
                     /protein_id="XP_013101563.1"
                     /db_xref="GeneID:106083219"
                     /translation="MTSGARDYGELRNDEKFINCVENFDESLDKIEASIQTAIGFKDY
                     EELSTQERVKLDNYLAYSINSLYWMYVKLQGLDPNEHGIKNELSRTRQTILRDKEIYE
                     RNTIRPKLDKGAAGRFIKHGLHLRYDKEGNPINDKGEHSNRDEPMEN"
     misc_feature    144..389
                     /gene="LOC106083219"
                     /note="Sas10/Utp3/C1D family; Region: Sas10_Utp3;
                     pfam04000"
                     /db_xref="CDD:461123"
     polyA_site      606
                     /gene="LOC106083219"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgttttcaa acaaattttg cttttgacgt tttaactaag tgcaagccat ttaaagtatt
       61 tatatcatca attagaattt tgaaaagaaa tcctactcaa aatgacttca ggtgcccgag
      121 attatggaga actacgaaat gatgaaaagt tcatcaattg cgtggaaaac ttcgatgaaa
      181 gtttggataa aattgaggct tcaatacaaa cagcaattgg ttttaaggac tatgaagagt
      241 tatctacaca ggaacgggtt aaactggaca attatttggc atattcgatt aactcacttt
      301 actggatgta tgtcaagcta caaggattgg atcctaatga gcatggcatt aaaaatgaac
      361 tgtcccgtac tcgacaaacg atattgagag ataaggaaat ctatgaacgt aacaccatac
      421 gtcccaaact agacaaagga gcagctggtc gttttattaa gcatggttta catctacgat
      481 atgacaaaga aggcaatccc ataaatgaca aaggagaaca tagtaataga gatgaaccaa
      541 tggaaaatta gttgtaaata gacctcattt gaattttcat actttaaaaa gagattcagc
      601 cgttta