Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106083216),


LOCUS       XM_013246105             702 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013246105
VERSION     XM_013246105.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246105.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..702
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..702
                     /gene="LOC106083216"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106083216"
     CDS             35..514
                     /gene="LOC106083216"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013101559.1"
                     /db_xref="GeneID:106083216"
                     /translation="MTKLKLNLQIILIIELIVLLCLGHGVNANGQATNISADYHIETE
                     SKGNWFKAFNGCTAKRMNLVSLDTKEKTEALTTELKKVFGNDHPNIWIGGNDNKKNRE
                     FIWMTANKAFGYTNWAPGQPDNKHGVEHCVMLWENHNYRWNDGNCLAKLAYVCEKRN"
     misc_feature    149..505
                     /gene="LOC106083216"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(419..421,431..433,437..439,455..457,461..472,
                     479..487)
                     /gene="LOC106083216"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     polyA_site      702
                     /gene="LOC106083216"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgatttcag tacatttcag tattttgagt taaaatgacc aaattaaaat taaatttaca
       61 aattattttg ataattgaat taattgttct attgtgccta gggcatggtg tcaatgccaa
      121 tggacaggca acaaatattt ccgcggacta ccatatagaa actgagagta agggaaattg
      181 gtttaaagcc ttcaatgggt gtaccgccaa acgtatgaat ctagtctcat tggataccaa
      241 agagaagact gaggccctga caacagaatt gaaaaaagta tttggcaatg accatcccaa
      301 tatctggatt ggtggcaatg acaataagaa aaatcgcgaa tttatttgga tgactgcaaa
      361 caaggcattc ggttatacca attgggcccc tggccaaccg gataacaagc atggagtcga
      421 gcattgtgtt atgctttggg aaaatcacaa ttatcgttgg aatgatggca actgtttggc
      481 caagttggct tatgtttgtg aaaagcgaaa ctaggttaga gagttagtta tactaaaaac
      541 cttaaaagta agaaaaaata aaataatatt aagcctatag taaatacagt gtggttcata
      601 tgagctcagg cggggtattt tttttttttt gtacatatct gttatttcac taaaaatttc
      661 cacatatatt tttgccaact caaacgatat ggcaaccatc aa