Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246105 702 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013246105 VERSION XM_013246105.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246105.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..702 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..702 /gene="LOC106083216" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106083216" CDS 35..514 /gene="LOC106083216" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_013101559.1" /db_xref="GeneID:106083216" /translation="MTKLKLNLQIILIIELIVLLCLGHGVNANGQATNISADYHIETE SKGNWFKAFNGCTAKRMNLVSLDTKEKTEALTTELKKVFGNDHPNIWIGGNDNKKNRE FIWMTANKAFGYTNWAPGQPDNKHGVEHCVMLWENHNYRWNDGNCLAKLAYVCEKRN" misc_feature 149..505 /gene="LOC106083216" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(419..421,431..433,437..439,455..457,461..472, 479..487) /gene="LOC106083216" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" polyA_site 702 /gene="LOC106083216" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgatttcag tacatttcag tattttgagt taaaatgacc aaattaaaat taaatttaca 61 aattattttg ataattgaat taattgttct attgtgccta gggcatggtg tcaatgccaa 121 tggacaggca acaaatattt ccgcggacta ccatatagaa actgagagta agggaaattg 181 gtttaaagcc ttcaatgggt gtaccgccaa acgtatgaat ctagtctcat tggataccaa 241 agagaagact gaggccctga caacagaatt gaaaaaagta tttggcaatg accatcccaa 301 tatctggatt ggtggcaatg acaataagaa aaatcgcgaa tttatttgga tgactgcaaa 361 caaggcattc ggttatacca attgggcccc tggccaaccg gataacaagc atggagtcga 421 gcattgtgtt atgctttggg aaaatcacaa ttatcgttgg aatgatggca actgtttggc 481 caagttggct tatgtttgtg aaaagcgaaa ctaggttaga gagttagtta tactaaaaac 541 cttaaaagta agaaaaaata aaataatatt aagcctatag taaatacagt gtggttcata 601 tgagctcagg cggggtattt tttttttttt gtacatatct gttatttcac taaaaatttc 661 cacatatatt tttgccaact caaacgatat ggcaaccatc aa