Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246102 869 bp mRNA linear INV 02-SEP-2023 (LOC106083213), mRNA. ACCESSION XM_013246102 VERSION XM_013246102.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246102.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..869 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..869 /gene="LOC106083213" /note="uncharacterized LOC106083213; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106083213" CDS 107..868 /gene="LOC106083213" /codon_start=1 /product="uncharacterized protein LOC106083213" /protein_id="XP_013101556.2" /db_xref="GeneID:106083213" /translation="MSVKLKKQKKIKKQSITKQETASDEVEMSDAEIEQQEENQEEDD GTGLAHESSNENEGEHDDDDDEMDLANFQTSDNKPKKKRKKGIIYISNIPKHMNVTRI REFLGEYGNIGRVYLQPEKLPGGDDKKKKKRKPFARHFTEGWVEFESKRVAKQIVPLL NNKQISSRKKSQFFDYLWSMKYLPRFKWCHLTERMNYEQAVHKQRLMAEVSQARKETT FFQNNLDKSDFIKKKETKLKRLQEKKANKKVNAES" polyA_site 869 /gene="LOC106083213" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgaaagcaac tgtcagaata ttgttttgat atttttcatt tgcgtcacaa aaatatagaa 61 aaaatcccta caaataacaa aatttaagaa acctttaaaa ggaaaaatgt cggttaaact 121 taaaaaacaa aagaaaataa agaaacaatc gataaccaaa caagaaactg catcagatga 181 agttgaaatg tcagatgctg aaatagagca acaggaagaa aaccaagagg aagacgatgg 241 caccgggtta gctcatgaaa gctctaatga aaatgaaggg gaacacgatg atgatgatga 301 tgaaatggat ttggccaatt ttcaaacaag tgacaataaa ccaaaaaaga aacgaaaaaa 361 aggcatcatc tatatatcca atatacccaa acacatgaat gttacacgca tacgagaatt 421 tctgggagaa tatggaaaca ttggacgtgt ttatctacag ccagaaaagc tgccaggtgg 481 ggacgataaa aagaagaaaa aacgtaaacc ctttgcccgt catttcaccg aaggatgggt 541 ggaattcgaa tccaaacgtg tggccaaaca aattgtacct ctactcaaca ataagcagat 601 ctcctcacga aaaaaatccc aattctttga ttacctctgg agcatgaaat atctgcctcg 661 tttcaaatgg tgccatctta ccgaacgtat gaactatgaa caggcagtgc acaaacaacg 721 tctgatggct gaagtgtcac aggcacgcaa agagactaca ttcttccaaa ataatctgga 781 taaaagtgat tttattaaga agaaagaaac gaagttgaag agactacaag aaaagaaagc 841 aaataaaaaa gttaatgctg aaagttaaa