Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106083213


LOCUS       XM_013246102             869 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083213), mRNA.
ACCESSION   XM_013246102
VERSION     XM_013246102.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246102.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..869
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..869
                     /gene="LOC106083213"
                     /note="uncharacterized LOC106083213; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106083213"
     CDS             107..868
                     /gene="LOC106083213"
                     /codon_start=1
                     /product="uncharacterized protein LOC106083213"
                     /protein_id="XP_013101556.2"
                     /db_xref="GeneID:106083213"
                     /translation="MSVKLKKQKKIKKQSITKQETASDEVEMSDAEIEQQEENQEEDD
                     GTGLAHESSNENEGEHDDDDDEMDLANFQTSDNKPKKKRKKGIIYISNIPKHMNVTRI
                     REFLGEYGNIGRVYLQPEKLPGGDDKKKKKRKPFARHFTEGWVEFESKRVAKQIVPLL
                     NNKQISSRKKSQFFDYLWSMKYLPRFKWCHLTERMNYEQAVHKQRLMAEVSQARKETT
                     FFQNNLDKSDFIKKKETKLKRLQEKKANKKVNAES"
     polyA_site      869
                     /gene="LOC106083213"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgaaagcaac tgtcagaata ttgttttgat atttttcatt tgcgtcacaa aaatatagaa
       61 aaaatcccta caaataacaa aatttaagaa acctttaaaa ggaaaaatgt cggttaaact
      121 taaaaaacaa aagaaaataa agaaacaatc gataaccaaa caagaaactg catcagatga
      181 agttgaaatg tcagatgctg aaatagagca acaggaagaa aaccaagagg aagacgatgg
      241 caccgggtta gctcatgaaa gctctaatga aaatgaaggg gaacacgatg atgatgatga
      301 tgaaatggat ttggccaatt ttcaaacaag tgacaataaa ccaaaaaaga aacgaaaaaa
      361 aggcatcatc tatatatcca atatacccaa acacatgaat gttacacgca tacgagaatt
      421 tctgggagaa tatggaaaca ttggacgtgt ttatctacag ccagaaaagc tgccaggtgg
      481 ggacgataaa aagaagaaaa aacgtaaacc ctttgcccgt catttcaccg aaggatgggt
      541 ggaattcgaa tccaaacgtg tggccaaaca aattgtacct ctactcaaca ataagcagat
      601 ctcctcacga aaaaaatccc aattctttga ttacctctgg agcatgaaat atctgcctcg
      661 tttcaaatgg tgccatctta ccgaacgtat gaactatgaa caggcagtgc acaaacaacg
      721 tctgatggct gaagtgtcac aggcacgcaa agagactaca ttcttccaaa ataatctgga
      781 taaaagtgat tttattaaga agaaagaaac gaagttgaag agactacaag aaaagaaagc
      841 aaataaaaaa gttaatgctg aaagttaaa