Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246100 1336 bp mRNA linear INV 02-SEP-2023 (LOC106083211), mRNA. ACCESSION XM_013246100 VERSION XM_013246100.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246100.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1336 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1336 /gene="LOC106083211" /note="chitinase-3-like protein 1; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106083211" CDS 82..1197 /gene="LOC106083211" /codon_start=1 /product="chitinase-3-like protein 1" /protein_id="XP_013101554.2" /db_xref="GeneID:106083211" /translation="MLKISGLSIISLFAHVGAFYYDEKKINCYFGSWAVVRTEQPLEL ELIDPQLCTHLSCVHFDVASDGTLEAYKNPNDDNLVASKRAMTLKSKNPQLKVIAVVG GPNTNFIAIATNRTKQAIFKYTTLRVLTKYGFDGLDLFWPSLGVATGKEMKSIAKFLI SMKYGMKAFNLTLGASLNGEVNDIQSWSKIPNIYLNYELDYINVMAYNFSTTIYHAPL YGNTNNTVENSMQVLSQNLVSASARLLLGVAFIGQAYQVSKGGYGRSNVVTLNARSFK RYVRYLDMCTEEQTNDIYYADEFGATFIKSRLSWTSYESVKTVVMKAEYAQELGLGGI AIWLLDDDDFLGRCGKRYPLLRAIHKTMNGPKDYDKL" polyA_site 1336 /gene="LOC106083211" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gctttaaatg attttagaag cgagtaacaa gctttacgta gtacattcct tttcgtctgc 61 gaaagttttc actttaagga tatgctaaaa atcagtggcc tctcaatcat atcacttttt 121 gcccatgtgg gtgcttttta ttatgatgag aaaaaaatca attgttattt tggctcttgg 181 gctgtagtgc gaacggaaca accattggaa cttgaattga ttgatcccca attgtgtact 241 catttgagtt gtgttcactt tgatgtggcc agcgatggca cattggaagc ctataaaaat 301 ccaaatgatg acaatctagt ggctagtaaa cgagccatga ctttaaaatc gaaaaatcca 361 cagttaaaag ttattgctgt tgttggtggc ccaaatacaa atttcattgc aatagcaacc 421 aatcgaacaa agcaggcaat tttcaaatat acaactttga gggtgctcac aaaatatggc 481 tttgatgggc ttgatttgtt ttggccgagt ttaggagttg ctaccggaaa ggagatgaaa 541 tcaattgcaa agtttctgat tagtatgaaa tatggtatga aggcctttaa tcttactttg 601 ggcgcctcgc taaacggtga ggtcaacgac attcaatcat ggtctaaaat acccaacatt 661 tatcttaact acgagcttga ttacatcaat gtcatggcct acaactttag cactaccatc 721 tatcatgcac ccttgtatgg caacactaat aatactgtgg aaaattccat gcaagttctg 781 tctcagaatc tagtatccgc ctctgccaga ttgctcttgg gcgtggcttt tattggtcaa 841 gcctaccagg tgagtaaagg aggctatggg cgttccaatg ttgttacttt gaatgcacgc 901 tcttttaaac gttacgtccg ttatttggat atgtgtacag aggagcagac aaacgatatt 961 tactatgccg atgaattcgg agcaactttc attaaatctc gtctttcttg gaccagctat 1021 gagagtgtca agaccgttgt aatgaaggcg gaatatgcac aggaattagg tcttggtggc 1081 atagccattt ggttactaga tgacgatgac tttcttggca ggtgcggcaa gagatatcca 1141 ctattgcgag cgattcataa aacaatgaat ggccctaagg actacgataa gctttgagag 1201 gaggcaatca ttattatagg cccccttata aaacaaagga gaaaaaataa cacaaaaaaa 1261 catggaactt ttaaaaacca atttttgata tcatatacaa tttttgtgat tttaataaaa 1321 aaaaaattca cattta