Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans chitinase-3-like protein 1


LOCUS       XM_013246100            1336 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083211), mRNA.
ACCESSION   XM_013246100
VERSION     XM_013246100.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246100.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1336
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1336
                     /gene="LOC106083211"
                     /note="chitinase-3-like protein 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106083211"
     CDS             82..1197
                     /gene="LOC106083211"
                     /codon_start=1
                     /product="chitinase-3-like protein 1"
                     /protein_id="XP_013101554.2"
                     /db_xref="GeneID:106083211"
                     /translation="MLKISGLSIISLFAHVGAFYYDEKKINCYFGSWAVVRTEQPLEL
                     ELIDPQLCTHLSCVHFDVASDGTLEAYKNPNDDNLVASKRAMTLKSKNPQLKVIAVVG
                     GPNTNFIAIATNRTKQAIFKYTTLRVLTKYGFDGLDLFWPSLGVATGKEMKSIAKFLI
                     SMKYGMKAFNLTLGASLNGEVNDIQSWSKIPNIYLNYELDYINVMAYNFSTTIYHAPL
                     YGNTNNTVENSMQVLSQNLVSASARLLLGVAFIGQAYQVSKGGYGRSNVVTLNARSFK
                     RYVRYLDMCTEEQTNDIYYADEFGATFIKSRLSWTSYESVKTVVMKAEYAQELGLGGI
                     AIWLLDDDDFLGRCGKRYPLLRAIHKTMNGPKDYDKL"
     polyA_site      1336
                     /gene="LOC106083211"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gctttaaatg attttagaag cgagtaacaa gctttacgta gtacattcct tttcgtctgc
       61 gaaagttttc actttaagga tatgctaaaa atcagtggcc tctcaatcat atcacttttt
      121 gcccatgtgg gtgcttttta ttatgatgag aaaaaaatca attgttattt tggctcttgg
      181 gctgtagtgc gaacggaaca accattggaa cttgaattga ttgatcccca attgtgtact
      241 catttgagtt gtgttcactt tgatgtggcc agcgatggca cattggaagc ctataaaaat
      301 ccaaatgatg acaatctagt ggctagtaaa cgagccatga ctttaaaatc gaaaaatcca
      361 cagttaaaag ttattgctgt tgttggtggc ccaaatacaa atttcattgc aatagcaacc
      421 aatcgaacaa agcaggcaat tttcaaatat acaactttga gggtgctcac aaaatatggc
      481 tttgatgggc ttgatttgtt ttggccgagt ttaggagttg ctaccggaaa ggagatgaaa
      541 tcaattgcaa agtttctgat tagtatgaaa tatggtatga aggcctttaa tcttactttg
      601 ggcgcctcgc taaacggtga ggtcaacgac attcaatcat ggtctaaaat acccaacatt
      661 tatcttaact acgagcttga ttacatcaat gtcatggcct acaactttag cactaccatc
      721 tatcatgcac ccttgtatgg caacactaat aatactgtgg aaaattccat gcaagttctg
      781 tctcagaatc tagtatccgc ctctgccaga ttgctcttgg gcgtggcttt tattggtcaa
      841 gcctaccagg tgagtaaagg aggctatggg cgttccaatg ttgttacttt gaatgcacgc
      901 tcttttaaac gttacgtccg ttatttggat atgtgtacag aggagcagac aaacgatatt
      961 tactatgccg atgaattcgg agcaactttc attaaatctc gtctttcttg gaccagctat
     1021 gagagtgtca agaccgttgt aatgaaggcg gaatatgcac aggaattagg tcttggtggc
     1081 atagccattt ggttactaga tgacgatgac tttcttggca ggtgcggcaa gagatatcca
     1141 ctattgcgag cgattcataa aacaatgaat ggccctaagg actacgataa gctttgagag
     1201 gaggcaatca ttattatagg cccccttata aaacaaagga gaaaaaataa cacaaaaaaa
     1261 catggaactt ttaaaaacca atttttgata tcatatacaa tttttgtgat tttaataaaa
     1321 aaaaaattca cattta