Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans serine protease snake


LOCUS       XM_013246097            1357 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083208), transcript variant X2, mRNA.
ACCESSION   XM_013246097
VERSION     XM_013246097.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246097.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1357
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1357
                     /gene="LOC106083208"
                     /note="serine protease snake; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106083208"
     CDS             81..1256
                     /gene="LOC106083208"
                     /codon_start=1
                     /product="serine protease snake isoform X2"
                     /protein_id="XP_013101551.1"
                     /db_xref="GeneID:106083208"
                     /translation="MEYGYGNLIVFLFLILPNGNFGIPPLMPKADHGIVYPEDNWDHC
                     VLDHNGSQQQGQCVNVDNCLEVLIIWQKQNIYPKTCYFLKQELFVCCPKSTPLSGAET
                     VTVKTTENTMVANSTKLSFLELLKMKHRKSELECDLNTRAKLFVVHGTATKTDEFPFM
                     AALGWNSSFDAGIWYRCGGVVISPRFVLTAAHCADIGGDKASVVRIGGSNLTDVSVRD
                     VKIKRFIQHPGYKASEVYNDIALVELDEEVKDVYAACLWLEDNLDSENFIATGYGHTT
                     FGGLGSNQLLKVDLKAVTNKACSEFYPAGNDGAPNGITSTQLCAHDPEKLRDTCQGDS
                     GGPLILQRGISKRGYVVGITSFGLGCAGGAPGIYTRVSSYLDWIEPIVWPKLDTRSS"
     misc_feature    231..356
                     /gene="LOC106083208"
                     /note="Regulatory CLIP domain of proteinases; Region:
                     CLIP; cl02731"
                     /db_xref="CDD:470660"
     misc_feature    516..1217
                     /gene="LOC106083208"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    516..518
                     /gene="LOC106083208"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(654..656,792..794,1080..1082)
                     /gene="LOC106083208"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(1062..1064,1143..1145,1149..1151)
                     /gene="LOC106083208"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     polyA_site      1357
                     /gene="LOC106083208"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 actcttcaag gcatcttcag agcagcaacg aagactaaaa gtttgacgaa ccacttgtag
       61 agagatttaa gtgcttcaac atggagtatg gatatggaaa tttgattgtt ttcttgttct
      121 taattttgcc taatggaaat tttggcatac cccctctaat gcccaaagca gatcatggca
      181 tagtctatcc tgaagataat tgggatcatt gtgtacttga ccataatggc tcacaacagc
      241 aaggccaatg tgtcaatgtg gataattgtc tcgaagttct cattatatgg caaaaacaaa
      301 atatttatcc aaaaacgtgt tatttcctta aacaagaact gtttgtttgt tgccccaaat
      361 cgacgccact aagtggagct gaaactgtaa ccgtaaagac aacagagaat accatggtgg
      421 ccaactcaac taaacttagt tttttggagc tactgaaaat gaagcatcgt aaaagcgaat
      481 tggagtgtga cctcaacaca agagcaaaac tgtttgttgt gcatgggacc gcgaccaaaa
      541 cagatgaatt cccatttatg gctgcccttg gctggaactc cagttttgat gctggtatat
      601 ggtatcgttg tggtggtgtg gtaatttctc ccagatttgt cctaacagca gctcattgtg
      661 ccgacatagg aggtgataag gccagtgttg tacgtatagg tggctcaaat ttgacagatg
      721 tctctgtgag agatgttaaa ataaagcgat ttattcaaca ccctggatac aaagcatcag
      781 aggtgtacaa tgatatagca ctggtggaat tggatgagga agtgaaagat gtctatgctg
      841 cctgtctatg gcttgaggat aatttggatt ctgaaaattt catagccact ggttatggtc
      901 ataccacctt tggtggtttg ggctccaatc aactgttaaa agtcgacctg aaggcggtga
      961 caaacaaagc ttgctcggaa ttttatcccg ccggaaacga tggagctccc aatggtataa
     1021 ccagcacaca attatgtgcc catgatcctg aaaaattgcg tgacacatgc caaggtgatt
     1081 cggggggacc cttgatattg caaaggggta tcagcaagcg tggctatgtt gtgggcataa
     1141 catcatttgg tctgggctgt gctggtggag cacctggaat atataccaga gtttcatcgt
     1201 atttggattg gattgaaccc atcgtatggc caaaattgga tacgaggtct tcttagagta
     1261 gaaattaaaa aaaaaatata tataataaag tatttattac ttgaataaaa ataagccggg
     1321 tgttacattt gtattctacc ccaaatatct taatcta