Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246097 1357 bp mRNA linear INV 02-SEP-2023 (LOC106083208), transcript variant X2, mRNA. ACCESSION XM_013246097 VERSION XM_013246097.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246097.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1357 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1357 /gene="LOC106083208" /note="serine protease snake; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106083208" CDS 81..1256 /gene="LOC106083208" /codon_start=1 /product="serine protease snake isoform X2" /protein_id="XP_013101551.1" /db_xref="GeneID:106083208" /translation="MEYGYGNLIVFLFLILPNGNFGIPPLMPKADHGIVYPEDNWDHC VLDHNGSQQQGQCVNVDNCLEVLIIWQKQNIYPKTCYFLKQELFVCCPKSTPLSGAET VTVKTTENTMVANSTKLSFLELLKMKHRKSELECDLNTRAKLFVVHGTATKTDEFPFM AALGWNSSFDAGIWYRCGGVVISPRFVLTAAHCADIGGDKASVVRIGGSNLTDVSVRD VKIKRFIQHPGYKASEVYNDIALVELDEEVKDVYAACLWLEDNLDSENFIATGYGHTT FGGLGSNQLLKVDLKAVTNKACSEFYPAGNDGAPNGITSTQLCAHDPEKLRDTCQGDS GGPLILQRGISKRGYVVGITSFGLGCAGGAPGIYTRVSSYLDWIEPIVWPKLDTRSS" misc_feature 231..356 /gene="LOC106083208" /note="Regulatory CLIP domain of proteinases; Region: CLIP; cl02731" /db_xref="CDD:470660" misc_feature 516..1217 /gene="LOC106083208" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature 516..518 /gene="LOC106083208" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(654..656,792..794,1080..1082) /gene="LOC106083208" /note="active site" /db_xref="CDD:238113" misc_feature order(1062..1064,1143..1145,1149..1151) /gene="LOC106083208" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" polyA_site 1357 /gene="LOC106083208" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 actcttcaag gcatcttcag agcagcaacg aagactaaaa gtttgacgaa ccacttgtag 61 agagatttaa gtgcttcaac atggagtatg gatatggaaa tttgattgtt ttcttgttct 121 taattttgcc taatggaaat tttggcatac cccctctaat gcccaaagca gatcatggca 181 tagtctatcc tgaagataat tgggatcatt gtgtacttga ccataatggc tcacaacagc 241 aaggccaatg tgtcaatgtg gataattgtc tcgaagttct cattatatgg caaaaacaaa 301 atatttatcc aaaaacgtgt tatttcctta aacaagaact gtttgtttgt tgccccaaat 361 cgacgccact aagtggagct gaaactgtaa ccgtaaagac aacagagaat accatggtgg 421 ccaactcaac taaacttagt tttttggagc tactgaaaat gaagcatcgt aaaagcgaat 481 tggagtgtga cctcaacaca agagcaaaac tgtttgttgt gcatgggacc gcgaccaaaa 541 cagatgaatt cccatttatg gctgcccttg gctggaactc cagttttgat gctggtatat 601 ggtatcgttg tggtggtgtg gtaatttctc ccagatttgt cctaacagca gctcattgtg 661 ccgacatagg aggtgataag gccagtgttg tacgtatagg tggctcaaat ttgacagatg 721 tctctgtgag agatgttaaa ataaagcgat ttattcaaca ccctggatac aaagcatcag 781 aggtgtacaa tgatatagca ctggtggaat tggatgagga agtgaaagat gtctatgctg 841 cctgtctatg gcttgaggat aatttggatt ctgaaaattt catagccact ggttatggtc 901 ataccacctt tggtggtttg ggctccaatc aactgttaaa agtcgacctg aaggcggtga 961 caaacaaagc ttgctcggaa ttttatcccg ccggaaacga tggagctccc aatggtataa 1021 ccagcacaca attatgtgcc catgatcctg aaaaattgcg tgacacatgc caaggtgatt 1081 cggggggacc cttgatattg caaaggggta tcagcaagcg tggctatgtt gtgggcataa 1141 catcatttgg tctgggctgt gctggtggag cacctggaat atataccaga gtttcatcgt 1201 atttggattg gattgaaccc atcgtatggc caaaattgga tacgaggtct tcttagagta 1261 gaaattaaaa aaaaaatata tataataaag tatttattac ttgaataaaa ataagccggg 1321 tgttacattt gtattctacc ccaaatatct taatcta