PREDICTED: Stomoxys calcitrans lectin subunit alpha-like

LOCUS       XM_013246089             543 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083202), mRNA.
ACCESSION   XM_013246089
VERSION     XM_013246089.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246089.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 11% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..543
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..543
                     /gene="LOC106083202"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106083202"
     CDS             1..543
                     /gene="LOC106083202"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013101543.2"
                     /db_xref="GeneID:106083202"
                     /translation="MVLLKLSLLTLVALQVTSAVPYDKCDKPEKDELEEYGNVFIEHE
                     QKYNWFEAWNECAMRNMTLMAIDTAERHGVMNSMLRKRFTKCPNLWIGGNDLGEEGKF
                     VWSPTGRPFEFSNWQKGQPDNYKSNENCVHYYDITDFEWNDAACSLKMGFICEENRFQ
                     VAARRDLKMKKQFIDHLFEM"
ORIGIN      
        1 atggtcttgt taaaattgtc attgttaact ttggtggctt tgcaagtgac ttcagctgtt
       61 ccctatgata agtgcgataa acccgagaaa gatgaattgg aagagtatgg aaacgttttc
      121 attgaacatg agcagaagta caattggttt gaggcctgga atgaatgtgc catgcgaaat
      181 atgaccctca tggccataga tacagccgaa aggcatggag tcatgaattc aatgctacgt
      241 aaacgattca ctaaatgtcc caatttatgg attggcggca atgatcttgg tgaagaagga
      301 aaattcgttt ggtccccgac tggtagacct tttgaatttt ccaactggca aaagggacaa
      361 ccggataact acaagagcaa cgagaattgt gtgcattact atgacataac ggattttgaa
      421 tggaacgatg cagcgtgttc acttaaaatg ggttttattt gtgaggaaaa tcgcttccaa
      481 gtggccgcac gtcgtgattt aaaaatgaaa aaacaattca tagatcattt gttcgaaatg
      541 taa