Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246073 604 bp mRNA linear INV 02-SEP-2023 (LOC106083189), mRNA. ACCESSION XM_013246073 VERSION XM_013246073.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246073.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..604 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..604 /gene="LOC106083189" /note="general odorant-binding protein 28a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 Proteins" /db_xref="GeneID:106083189" CDS 40..486 /gene="LOC106083189" /codon_start=1 /product="general odorant-binding protein 28a" /protein_id="XP_013101527.2" /db_xref="GeneID:106083189" /translation="MAKCIITVSVLCVLAAVAVRGEVDKKAAMADFVAKSDSCKAEVG AKEADVAEMMAKKPASSTEGKCLRSCVMKMYEVMDSQGKFVSSVALQHAETYSDGAAD QMKMAQEIIDACSGIAVPSDHCEAAEEYGKCFMEQAKAHGLSEFKM" polyA_site 604 /gene="LOC106083189" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttaactggat aagcattaac ttgattgtaa actttcatta tggctaaatg tatcataaca 61 gtgtctgtct tatgcgtttt ggcagctgtt gcagttcgcg gtgaagttga taaaaaggct 121 gccatggccg attttgtggc taaatcagac tcatgtaaag ctgaagtggg tgccaaggaa 181 gctgatgtag ctgagatgat ggccaaaaag cccgcttcct ctactgaagg taaatgcttg 241 cgttcatgtg ttatgaaaat gtatgaagtg atggattccc agggcaaatt tgtctcatct 301 gttgctttgc aacacgctga aacatattca gatggtgctg cagatcaaat gaagatggct 361 caagaaatta ttgatgcctg ctctggtatt gctgtgccat cggatcactg tgaagctgct 421 gaagaatatg gcaaatgttt tatggaacaa gccaaggcac atggtctttc cgaatttaaa 481 atgtaaattg gattaaattg tgcattacga aaaatgctta ccgttttgtt atacttactc 541 tgacagtctt taaatcaaaa attttaaatt aaagcaatgt gtaaataaaa ttaccgaata 601 ttaa