Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans general odorant-binding protein 28a


LOCUS       XM_013246073             604 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083189), mRNA.
ACCESSION   XM_013246073
VERSION     XM_013246073.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246073.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..604
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..604
                     /gene="LOC106083189"
                     /note="general odorant-binding protein 28a; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 18 Proteins"
                     /db_xref="GeneID:106083189"
     CDS             40..486
                     /gene="LOC106083189"
                     /codon_start=1
                     /product="general odorant-binding protein 28a"
                     /protein_id="XP_013101527.2"
                     /db_xref="GeneID:106083189"
                     /translation="MAKCIITVSVLCVLAAVAVRGEVDKKAAMADFVAKSDSCKAEVG
                     AKEADVAEMMAKKPASSTEGKCLRSCVMKMYEVMDSQGKFVSSVALQHAETYSDGAAD
                     QMKMAQEIIDACSGIAVPSDHCEAAEEYGKCFMEQAKAHGLSEFKM"
     polyA_site      604
                     /gene="LOC106083189"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttaactggat aagcattaac ttgattgtaa actttcatta tggctaaatg tatcataaca
       61 gtgtctgtct tatgcgtttt ggcagctgtt gcagttcgcg gtgaagttga taaaaaggct
      121 gccatggccg attttgtggc taaatcagac tcatgtaaag ctgaagtggg tgccaaggaa
      181 gctgatgtag ctgagatgat ggccaaaaag cccgcttcct ctactgaagg taaatgcttg
      241 cgttcatgtg ttatgaaaat gtatgaagtg atggattccc agggcaaatt tgtctcatct
      301 gttgctttgc aacacgctga aacatattca gatggtgctg cagatcaaat gaagatggct
      361 caagaaatta ttgatgcctg ctctggtatt gctgtgccat cggatcactg tgaagctgct
      421 gaagaatatg gcaaatgttt tatggaacaa gccaaggcac atggtctttc cgaatttaaa
      481 atgtaaattg gattaaattg tgcattacga aaaatgctta ccgttttgtt atacttactc
      541 tgacagtctt taaatcaaaa attttaaatt aaagcaatgt gtaaataaaa ttaccgaata
      601 ttaa