Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013246061 635 bp mRNA linear INV 02-SEP-2023 (LOC106083179), mRNA. ACCESSION XM_013246061 VERSION XM_013246061.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013246061.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..635 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..635 /gene="LOC106083179" /note="general odorant-binding protein 28a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 11 Proteins" /db_xref="GeneID:106083179" CDS 70..516 /gene="LOC106083179" /codon_start=1 /product="general odorant-binding protein 28a" /protein_id="XP_013101515.1" /db_xref="GeneID:106083179" /translation="MAKYLVTLAVLCVIGAVLVRGELDKNAIIADFMAKAEVCKGETG GKDADVAEIAGKKPASTPEGKCMRSCLMKKYEVMDANGKMDKAVAMKHAEVLSDGDAK MLAIADEVVATCAALGVSGDHCEAAEEYLKCFKEQAMAHGVDDIDF" misc_feature 148..480 /gene="LOC106083179" /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395" /db_xref="CDD:460193" misc_feature order(163..165,271..273,283..285,301..303,448..450, 469..471) /gene="LOC106083179" /note="ligand binding site [chemical binding]; other site" /db_xref="CDD:467938" polyA_site 635 /gene="LOC106083179" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aattgtaagc taaagttgaa aacattttaa ttaaagttaa aacaaaaagt gatcaaaatt 61 tgtacaaaaa tggcaaagta tttagtgaca ttggcagttt tgtgtgttat tggagctgtc 121 ctagtccgtg gagaacttga taagaatgct atcatagctg atttcatggc taaggctgag 181 gtgtgcaaag gcgagactgg tggcaaggat gccgatgttg ccgaaattgc aggaaaaaaa 241 ccagcatcca ctcccgaagg caagtgtatg cgttcatgcc ttatgaaaaa atatgaagtg 301 atggacgcca atggtaaaat ggataaagcc gttgccatga aacatgctga ggtgttatcg 361 gatggtgatg ccaaaatgtt ggcaatagcc gatgaagttg tcgcaacttg cgctgcccta 421 ggagtatcgg gagaccattg tgaagctgca gaggaatatc tgaaatgctt taaggagcag 481 gctatggccc atggtgttga tgatattgat ttttaaataa aaaacgaaca aacgctgtta 541 aggactcaaa cacacacaca atcacacgtt atgctttcct ctttaattta gtgtttaaat 601 aaatttgaaa caaaataatg gttatcgctt gcaaa