Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans general odorant-binding protein 28a


LOCUS       XM_013246061             635 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106083179), mRNA.
ACCESSION   XM_013246061
VERSION     XM_013246061.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013246061.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..635
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..635
                     /gene="LOC106083179"
                     /note="general odorant-binding protein 28a; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 EST, 11 Proteins"
                     /db_xref="GeneID:106083179"
     CDS             70..516
                     /gene="LOC106083179"
                     /codon_start=1
                     /product="general odorant-binding protein 28a"
                     /protein_id="XP_013101515.1"
                     /db_xref="GeneID:106083179"
                     /translation="MAKYLVTLAVLCVIGAVLVRGELDKNAIIADFMAKAEVCKGETG
                     GKDADVAEIAGKKPASTPEGKCMRSCLMKKYEVMDANGKMDKAVAMKHAEVLSDGDAK
                     MLAIADEVVATCAALGVSGDHCEAAEEYLKCFKEQAMAHGVDDIDF"
     misc_feature    148..480
                     /gene="LOC106083179"
                     /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395"
                     /db_xref="CDD:460193"
     misc_feature    order(163..165,271..273,283..285,301..303,448..450,
                     469..471)
                     /gene="LOC106083179"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:467938"
     polyA_site      635
                     /gene="LOC106083179"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aattgtaagc taaagttgaa aacattttaa ttaaagttaa aacaaaaagt gatcaaaatt
       61 tgtacaaaaa tggcaaagta tttagtgaca ttggcagttt tgtgtgttat tggagctgtc
      121 ctagtccgtg gagaacttga taagaatgct atcatagctg atttcatggc taaggctgag
      181 gtgtgcaaag gcgagactgg tggcaaggat gccgatgttg ccgaaattgc aggaaaaaaa
      241 ccagcatcca ctcccgaagg caagtgtatg cgttcatgcc ttatgaaaaa atatgaagtg
      301 atggacgcca atggtaaaat ggataaagcc gttgccatga aacatgctga ggtgttatcg
      361 gatggtgatg ccaaaatgtt ggcaatagcc gatgaagttg tcgcaacttg cgctgcccta
      421 ggagtatcgg gagaccattg tgaagctgca gaggaatatc tgaaatgctt taaggagcag
      481 gctatggccc atggtgttga tgatattgat ttttaaataa aaaacgaaca aacgctgtta
      541 aggactcaaa cacacacaca atcacacgtt atgctttcct ctttaattta gtgtttaaat
      601 aaatttgaaa caaaataatg gttatcgctt gcaaa