Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245902 748 bp mRNA linear INV 02-SEP-2023 uL30m (LOC106083070), mRNA. ACCESSION XM_013245902 VERSION XM_013245902.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245902.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..748 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..748 /gene="LOC106083070" /note="large ribosomal subunit protein uL30m; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106083070" CDS 93..641 /gene="LOC106083070" /codon_start=1 /product="large ribosomal subunit protein uL30m" /protein_id="XP_013101356.2" /db_xref="GeneID:106083070" /translation="MMSLKTVISTSGNGCLQAIRHYGKHNKKFLYKDGQRCGNIIYYP RTPDHQDPPVEPAKLFRVQRIKPVKGNPYWEKRLLKELGLDGKQGDFTVVKNIPENNA RLWKIKHLIQVTPITFPHGEPTENDIKHTWLKENGECIVTKEIGPVEDRIKSLESFEK DPKRLDTDLLKRDSRMKWQNPW" polyA_site 748 /gene="LOC106083070" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agttaattca acatcagctg ttgtttttat tctttcataa cctgcttcct cgatattgaa 61 tttgaaattg cttgcgattg aaactaattg aaatgatgtc tttaaaaacc gtaatatcta 121 cgtccggaaa tgggtgccta caagctatac gtcattatgg aaaacacaac aagaaattct 181 tgtataagga tggccaaaga tgtggaaata ttatttacta tccccgcact cctgaccacc 241 aagacccacc cgtagaacca gctaaactat tccgagtaca acgcattaag cctgtaaagg 301 gcaatcctta ttgggaaaag aggctactga aagaattggg attagatgga aagcaaggcg 361 attttactgt cgtgaaaaat attcccgaaa acaatgctcg gctttggaag ataaagcatt 421 tgattcaagt aacgccaatt acatttcctc acggtgaacc cactgaaaac gatattaaac 481 atacatggct taaagaaaac ggcgaatgta ttgtgacaaa ggaaatcggt ccagtggaag 541 acagaataaa atctttggaa tcttttgaaa aggatcccaa acgcctggac acggatttgc 601 ttaaaagaga ctcacgaatg aaatggcaaa atccgtggta gaaaaattaa gaggtttatt 661 aatatctcga cttgttaaca acgttataaa aatgaaacat tataaataga aaagcaataa 721 aattcacata atatgcttaa aaaaaaaa