Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans large ribosomal subunit protein


LOCUS       XM_013245902             748 bp    mRNA    linear   INV 02-SEP-2023
            uL30m (LOC106083070), mRNA.
ACCESSION   XM_013245902
VERSION     XM_013245902.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245902.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..748
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..748
                     /gene="LOC106083070"
                     /note="large ribosomal subunit protein uL30m; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106083070"
     CDS             93..641
                     /gene="LOC106083070"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL30m"
                     /protein_id="XP_013101356.2"
                     /db_xref="GeneID:106083070"
                     /translation="MMSLKTVISTSGNGCLQAIRHYGKHNKKFLYKDGQRCGNIIYYP
                     RTPDHQDPPVEPAKLFRVQRIKPVKGNPYWEKRLLKELGLDGKQGDFTVVKNIPENNA
                     RLWKIKHLIQVTPITFPHGEPTENDIKHTWLKENGECIVTKEIGPVEDRIKSLESFEK
                     DPKRLDTDLLKRDSRMKWQNPW"
     polyA_site      748
                     /gene="LOC106083070"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agttaattca acatcagctg ttgtttttat tctttcataa cctgcttcct cgatattgaa
       61 tttgaaattg cttgcgattg aaactaattg aaatgatgtc tttaaaaacc gtaatatcta
      121 cgtccggaaa tgggtgccta caagctatac gtcattatgg aaaacacaac aagaaattct
      181 tgtataagga tggccaaaga tgtggaaata ttatttacta tccccgcact cctgaccacc
      241 aagacccacc cgtagaacca gctaaactat tccgagtaca acgcattaag cctgtaaagg
      301 gcaatcctta ttgggaaaag aggctactga aagaattggg attagatgga aagcaaggcg
      361 attttactgt cgtgaaaaat attcccgaaa acaatgctcg gctttggaag ataaagcatt
      421 tgattcaagt aacgccaatt acatttcctc acggtgaacc cactgaaaac gatattaaac
      481 atacatggct taaagaaaac ggcgaatgta ttgtgacaaa ggaaatcggt ccagtggaag
      541 acagaataaa atctttggaa tcttttgaaa aggatcccaa acgcctggac acggatttgc
      601 ttaaaagaga ctcacgaatg aaatggcaaa atccgtggta gaaaaattaa gaggtttatt
      661 aatatctcga cttgttaaca acgttataaa aatgaaacat tataaataga aaagcaataa
      721 aattcacata atatgcttaa aaaaaaaa