Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245675 353 bp mRNA linear INV 02-SEP-2023 (LOC106082917), mRNA. ACCESSION XM_013245675 VERSION XM_013245675.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245675.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..353 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..353 /gene="LOC106082917" /note="uncharacterized LOC106082917; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106082917" CDS 50..328 /gene="LOC106082917" /codon_start=1 /product="uncharacterized protein LOC106082917" /protein_id="XP_013101129.1" /db_xref="GeneID:106082917" /translation="MKSFICLALFACLMASVLACDPDGNNQPTCGSGNVNVPIRNFWD PTAYWLCSSSGATADLVRCPDAHLFDSAKGECVMWNEWEWTFPCPENN" ORIGIN 1 cactagctac aagccagtca acattaaaca caacaccaat ttcagcaata tgaaatcttt 61 catctgtttg gcccttttcg cttgccttat ggcttcagtt ttggcctgtg atcccgatgg 121 caacaatcaa cccacctgcg gctctggcaa tgtaaatgtg cccattcgca acttctggga 181 tcccaccgct tactggttgt gtagctcttc aggagctacc gctgacttgg ttcgttgtcc 241 cgatgctcac ttgttcgatt ctgctaaggg cgaatgtgtt atgtggaatg aatgggaatg 301 gaccttccct tgtcccgaaa ataactaatt tgaaatgaaa taaaaaggat ttt