Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082917


LOCUS       XM_013245675             353 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082917), mRNA.
ACCESSION   XM_013245675
VERSION     XM_013245675.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245675.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..353
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..353
                     /gene="LOC106082917"
                     /note="uncharacterized LOC106082917; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106082917"
     CDS             50..328
                     /gene="LOC106082917"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082917"
                     /protein_id="XP_013101129.1"
                     /db_xref="GeneID:106082917"
                     /translation="MKSFICLALFACLMASVLACDPDGNNQPTCGSGNVNVPIRNFWD
                     PTAYWLCSSSGATADLVRCPDAHLFDSAKGECVMWNEWEWTFPCPENN"
ORIGIN      
        1 cactagctac aagccagtca acattaaaca caacaccaat ttcagcaata tgaaatcttt
       61 catctgtttg gcccttttcg cttgccttat ggcttcagtt ttggcctgtg atcccgatgg
      121 caacaatcaa cccacctgcg gctctggcaa tgtaaatgtg cccattcgca acttctggga
      181 tcccaccgct tactggttgt gtagctcttc aggagctacc gctgacttgg ttcgttgtcc
      241 cgatgctcac ttgttcgatt ctgctaaggg cgaatgtgtt atgtggaatg aatgggaatg
      301 gaccttccct tgtcccgaaa ataactaatt tgaaatgaaa taaaaaggat ttt