Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245674 378 bp mRNA linear INV 02-SEP-2023 (LOC106082916), mRNA. ACCESSION XM_013245674 VERSION XM_013245674.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245674.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..378 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..378 /gene="LOC106082916" /note="uncharacterized LOC106082916; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106082916" CDS 65..343 /gene="LOC106082916" /codon_start=1 /product="uncharacterized protein LOC106082916" /protein_id="XP_013101128.1" /db_xref="GeneID:106082916" /translation="MKFFAVLAILACVAASGLACDADENNKPTCATDNVNVPIRNFWD PTAYWQCNASSGQPELVHCPDSYLFDSAKGQCVIWNEWEWTNPCPANN" ORIGIN 1 tttgcattca acctcaatag gggaaatatc tctgcggaac tttaaccaac tctattttct 61 caaaatgaaa ttcttcgctg ttttggccat tttggcttgt gttgctgcca gtggtttggc 121 ctgtgatgcc gatgagaaca acaagcccac ctgcgccaca gataatgtga atgtaccaat 181 tcgcaacttc tgggatccta ccgcttattg gcaatgcaat gccagcagtg gtcaacccga 241 gttggtacat tgccctgatt cttacttgtt cgattcggcc aagggccaat gtgttatttg 301 gaatgaatgg gaatggacca atccctgccc tgcaaataac taatgttctt gaaatgatgt 361 cttgaataaa aaccgaaa