Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082916


LOCUS       XM_013245674             378 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082916), mRNA.
ACCESSION   XM_013245674
VERSION     XM_013245674.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245674.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..378
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..378
                     /gene="LOC106082916"
                     /note="uncharacterized LOC106082916; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106082916"
     CDS             65..343
                     /gene="LOC106082916"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082916"
                     /protein_id="XP_013101128.1"
                     /db_xref="GeneID:106082916"
                     /translation="MKFFAVLAILACVAASGLACDADENNKPTCATDNVNVPIRNFWD
                     PTAYWQCNASSGQPELVHCPDSYLFDSAKGQCVIWNEWEWTNPCPANN"
ORIGIN      
        1 tttgcattca acctcaatag gggaaatatc tctgcggaac tttaaccaac tctattttct
       61 caaaatgaaa ttcttcgctg ttttggccat tttggcttgt gttgctgcca gtggtttggc
      121 ctgtgatgcc gatgagaaca acaagcccac ctgcgccaca gataatgtga atgtaccaat
      181 tcgcaacttc tgggatccta ccgcttattg gcaatgcaat gccagcagtg gtcaacccga
      241 gttggtacat tgccctgatt cttacttgtt cgattcggcc aagggccaat gtgttatttg
      301 gaatgaatgg gaatggacca atccctgccc tgcaaataac taatgttctt gaaatgatgt
      361 cttgaataaa aaccgaaa