Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082915


LOCUS       XM_013245673             438 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082915), mRNA.
ACCESSION   XM_013245673
VERSION     XM_013245673.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245673.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..438
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..438
                     /gene="LOC106082915"
                     /note="uncharacterized LOC106082915; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106082915"
     CDS             93..374
                     /gene="LOC106082915"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082915"
                     /protein_id="XP_013101127.2"
                     /db_xref="GeneID:106082915"
                     /translation="MKNVLNFLVCLACFLAFVSACDPDSDNKPVCNDMTLNVPTRNFW
                     DPTAYWLCNYVGVEPELERCPDSHLFDSAKGECVLWNKWVWTNPCPATI"
     polyA_site      438
                     /gene="LOC106082915"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgcaattagt atcaagttat gataatatct tcaagcaagt gaaaacttca tcataatatc
       61 ttcaagcaag tgaaaacttt aaggaaagaa aaatgaaaaa cgttttaaac tttttggtct
      121 gtttggcttg ctttttggcc tttgtatcgg cctgtgaccc tgacagtgac aacaagcctg
      181 tctgcaatga tatgacttta aatgtgccca ctcgtaactt ctgggatccc acagcctatt
      241 ggttgtgtaa ttatgtcggt gttgaacctg aattggagcg ttgtcccgat tcccatttgt
      301 ttgattcggc caagggagaa tgtgtcttgt ggaataaatg ggtgtggacc aatccctgcc
      361 cagccaccat ctaggaagaa tgggttaaaa tgtttgaatg aatatacgaa gcatatgtct
      421 tttttgtccc aaggataa