Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245673 438 bp mRNA linear INV 02-SEP-2023 (LOC106082915), mRNA. ACCESSION XM_013245673 VERSION XM_013245673.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245673.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..438 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..438 /gene="LOC106082915" /note="uncharacterized LOC106082915; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106082915" CDS 93..374 /gene="LOC106082915" /codon_start=1 /product="uncharacterized protein LOC106082915" /protein_id="XP_013101127.2" /db_xref="GeneID:106082915" /translation="MKNVLNFLVCLACFLAFVSACDPDSDNKPVCNDMTLNVPTRNFW DPTAYWLCNYVGVEPELERCPDSHLFDSAKGECVLWNKWVWTNPCPATI" polyA_site 438 /gene="LOC106082915" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgcaattagt atcaagttat gataatatct tcaagcaagt gaaaacttca tcataatatc 61 ttcaagcaag tgaaaacttt aaggaaagaa aaatgaaaaa cgttttaaac tttttggtct 121 gtttggcttg ctttttggcc tttgtatcgg cctgtgaccc tgacagtgac aacaagcctg 181 tctgcaatga tatgacttta aatgtgccca ctcgtaactt ctgggatccc acagcctatt 241 ggttgtgtaa ttatgtcggt gttgaacctg aattggagcg ttgtcccgat tcccatttgt 301 ttgattcggc caagggagaa tgtgtcttgt ggaataaatg ggtgtggacc aatccctgcc 361 cagccaccat ctaggaagaa tgggttaaaa tgtttgaatg aatatacgaa gcatatgtct 421 tttttgtccc aaggataa