Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082907


LOCUS       XM_013245661             529 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082907), mRNA.
ACCESSION   XM_013245661
VERSION     XM_013245661.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245661.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..529
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..529
                     /gene="LOC106082907"
                     /note="uncharacterized LOC106082907; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106082907"
     CDS             104..244
                     /gene="LOC106082907"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082907"
                     /protein_id="XP_013101115.1"
                     /db_xref="GeneID:106082907"
                     /translation="MAEEKLTGLGKIFNGNTTAGRANVGKATYAVIGLIIAYNMMKPK
                     KK"
     misc_feature    107..238
                     /gene="LOC106082907"
                     /note="ATP synthase regulation; Region: ATP_synth_reg;
                     pfam14960"
                     /db_xref="CDD:434349"
     polyA_site      529
                     /gene="LOC106082907"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attttgacaa ccgtcagttt tacataatag acataacctc gattttattt gacattagac
       61 aatttttgtt cacaaaggaa aaagtggtct ttaaacaaca acaatggcag aagaaaaatt
      121 aaccggtttg ggcaaaatct ttaatggcaa caccactgcc ggacgtgcta atgtcggtaa
      181 agctacttat gccgtaattg gtctaattat cgcctataac atgatgaagc ccaagaagaa
      241 gtagattctc ccctttgtta ttccctgaat gcatctttga tatcactcgt ttttgcaatg
      301 gggacttcgc ttttcgaggt gtgaggctgc ttctataacg cctgcattaa gttgtcttat
      361 tgttgttgta tttcgtaaaa ctttataaag attgcttgcg agtgtttcat ggataaaaat
      421 tcaaattttc ttattattat taaagttctg tgaacaatgg agaatttcta tgtgtaatta
      481 agtgaactac ttgttctaat cgaaataaaa tagttggaaa cacaacgta