Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245661 529 bp mRNA linear INV 02-SEP-2023 (LOC106082907), mRNA. ACCESSION XM_013245661 VERSION XM_013245661.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245661.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..529 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..529 /gene="LOC106082907" /note="uncharacterized LOC106082907; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106082907" CDS 104..244 /gene="LOC106082907" /codon_start=1 /product="uncharacterized protein LOC106082907" /protein_id="XP_013101115.1" /db_xref="GeneID:106082907" /translation="MAEEKLTGLGKIFNGNTTAGRANVGKATYAVIGLIIAYNMMKPK KK" misc_feature 107..238 /gene="LOC106082907" /note="ATP synthase regulation; Region: ATP_synth_reg; pfam14960" /db_xref="CDD:434349" polyA_site 529 /gene="LOC106082907" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attttgacaa ccgtcagttt tacataatag acataacctc gattttattt gacattagac 61 aatttttgtt cacaaaggaa aaagtggtct ttaaacaaca acaatggcag aagaaaaatt 121 aaccggtttg ggcaaaatct ttaatggcaa caccactgcc ggacgtgcta atgtcggtaa 181 agctacttat gccgtaattg gtctaattat cgcctataac atgatgaagc ccaagaagaa 241 gtagattctc ccctttgtta ttccctgaat gcatctttga tatcactcgt ttttgcaatg 301 gggacttcgc ttttcgaggt gtgaggctgc ttctataacg cctgcattaa gttgtcttat 361 tgttgttgta tttcgtaaaa ctttataaag attgcttgcg agtgtttcat ggataaaaat 421 tcaaattttc ttattattat taaagttctg tgaacaatgg agaatttcta tgtgtaatta 481 agtgaactac ttgttctaat cgaaataaaa tagttggaaa cacaacgta