Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans RNA polymerase II subunit A


LOCUS       XM_013245657             777 bp    mRNA    linear   INV 02-SEP-2023
            C-terminal domain phosphatase SSU72 (LOC106082905), mRNA.
ACCESSION   XM_013245657
VERSION     XM_013245657.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245657.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..777
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..777
                     /gene="LOC106082905"
                     /note="RNA polymerase II subunit A C-terminal domain
                     phosphatase SSU72; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 9 Proteins"
                     /db_xref="GeneID:106082905"
     CDS             85..672
                     /gene="LOC106082905"
                     /codon_start=1
                     /product="RNA polymerase II subunit A C-terminal domain
                     phosphatase SSU72"
                     /protein_id="XP_013101111.1"
                     /db_xref="GeneID:106082905"
                     /translation="MSINSNLSIAVVCSSNMNRSMEAHNFLAKKGFYVRSFGVGQTVK
                     LPGTAIDKPNIYEFGTSYDYIYNDLSSKDKQYYTQNGLLHMLDRNRRIKKCPERFQEC
                     KEKFDIIVTVEERVYDQVLEYMESIDVTDNRPVHIFNVDIEDNHEEALMGAFLIADMI
                     IMMSKSSDLDNDIDELLQEFESRRNKTVLHSVLFY"
     misc_feature    103..669
                     /gene="LOC106082905"
                     /note="Ssu72-like protein; Region: Ssu72; pfam04722"
                     /db_xref="CDD:461410"
     polyA_site      777
                     /gene="LOC106082905"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtcatattt gtcaaagttt tcacaatcgt agagcctcat ttcggaattt atttaacagt
       61 tttaacaata aataacagta aaaaatgtcc attaacagca atttatccat agccgttgta
      121 tgctcatcaa atatgaatcg gtctatggag gcacacaatt tcctagccaa gaagggcttc
      181 tatgtacggt cttttggggt tggtcagact gtcaaattgc ccggaacagc gattgataaa
      241 cctaatatct atgaatttgg caccagctat gattacatct acaacgacct gagcagcaaa
      301 gacaaacaat actacacaca gaacggtttg ctgcacatgt tggatcgtaa tcgccgcatc
      361 aaaaagtgtc ccgaacgttt tcaagaatgc aaagaaaaat ttgatataat tgttacagtt
      421 gaggaacgtg tatacgatca ggttttggag tatatggaat caattgatgt aactgataac
      481 cgacctgtac atatatttaa tgttgatatc gaagataacc atgaagaagc attgatgggc
      541 gcgtttctta ttgcggacat gataattatg atgtcaaaat caagtgactt ggataatgat
      601 atagacgaac tcctgcaaga atttgaatcg aggcgcaata aaaccgtttt acattcggta
      661 ctcttctact gactgctggt gatatttatt tctcaatatg attttatttg ataaatatgt
      721 atatgctata aggatttgtt tataaccaat aatgaccaca gacaattgct gtcgtta