Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245657 777 bp mRNA linear INV 02-SEP-2023 C-terminal domain phosphatase SSU72 (LOC106082905), mRNA. ACCESSION XM_013245657 VERSION XM_013245657.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245657.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..777 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..777 /gene="LOC106082905" /note="RNA polymerase II subunit A C-terminal domain phosphatase SSU72; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106082905" CDS 85..672 /gene="LOC106082905" /codon_start=1 /product="RNA polymerase II subunit A C-terminal domain phosphatase SSU72" /protein_id="XP_013101111.1" /db_xref="GeneID:106082905" /translation="MSINSNLSIAVVCSSNMNRSMEAHNFLAKKGFYVRSFGVGQTVK LPGTAIDKPNIYEFGTSYDYIYNDLSSKDKQYYTQNGLLHMLDRNRRIKKCPERFQEC KEKFDIIVTVEERVYDQVLEYMESIDVTDNRPVHIFNVDIEDNHEEALMGAFLIADMI IMMSKSSDLDNDIDELLQEFESRRNKTVLHSVLFY" misc_feature 103..669 /gene="LOC106082905" /note="Ssu72-like protein; Region: Ssu72; pfam04722" /db_xref="CDD:461410" polyA_site 777 /gene="LOC106082905" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtcatattt gtcaaagttt tcacaatcgt agagcctcat ttcggaattt atttaacagt 61 tttaacaata aataacagta aaaaatgtcc attaacagca atttatccat agccgttgta 121 tgctcatcaa atatgaatcg gtctatggag gcacacaatt tcctagccaa gaagggcttc 181 tatgtacggt cttttggggt tggtcagact gtcaaattgc ccggaacagc gattgataaa 241 cctaatatct atgaatttgg caccagctat gattacatct acaacgacct gagcagcaaa 301 gacaaacaat actacacaca gaacggtttg ctgcacatgt tggatcgtaa tcgccgcatc 361 aaaaagtgtc ccgaacgttt tcaagaatgc aaagaaaaat ttgatataat tgttacagtt 421 gaggaacgtg tatacgatca ggttttggag tatatggaat caattgatgt aactgataac 481 cgacctgtac atatatttaa tgttgatatc gaagataacc atgaagaagc attgatgggc 541 gcgtttctta ttgcggacat gataattatg atgtcaaaat caagtgactt ggataatgat 601 atagacgaac tcctgcaaga atttgaatcg aggcgcaata aaaccgtttt acattcggta 661 ctcttctact gactgctggt gatatttatt tctcaatatg attttatttg ataaatatgt 721 atatgctata aggatttgtt tataaccaat aatgaccaca gacaattgct gtcgtta