Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans sugar transporter SWEET1


LOCUS       XM_013245648            1089 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082898), transcript variant X5, mRNA.
ACCESSION   XM_013245648
VERSION     XM_013245648.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245648.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1089
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1089
                     /gene="LOC106082898"
                     /note="sugar transporter SWEET1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:106082898"
     CDS             101..844
                     /gene="LOC106082898"
                     /codon_start=1
                     /product="sugar transporter SWEET1"
                     /protein_id="XP_013101102.1"
                     /db_xref="GeneID:106082898"
                     /translation="MEVLGDLLEPYSDEIAKFAGSITCLQFLSGVFLMNDIRKKGSSD
                     AYPPDPFIGGVVLTILSLKLGTLMGDEAMIKVNVIGFAINVVFMVIFYWYASGPFKSK
                     IWSKIGIASTFTMACLAYSNFEDPAKIEFRFGMLITAILVILVGMPLLSLGEIIEKKS
                     TEGLPFPLILSGTIVAAAWAAYGISIRNDVVTYQNLFLLLLSSIQLSLFAIYPNNPSS
                     ASPKEKDSPPYSKLQSDSPSKSKTNKKRD"
     misc_feature    152..385
                     /gene="LOC106082898"
                     /note="Sugar efflux transporter for intercellular
                     exchange; Region: MtN3_slv; cl46784"
                     /db_xref="CDD:481124"
     misc_feature    491..748
                     /gene="LOC106082898"
                     /note="Sugar efflux transporter for intercellular
                     exchange; Region: MtN3_slv; cl46784"
                     /db_xref="CDD:481124"
     polyA_site      1089
                     /gene="LOC106082898"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcccgtggca gctcgtttct cgtttcgacg ggtatgcatc agcaaaaaat actctgtata
       61 cgacgagagc acaagcactg caacaacgac cagtaacaac atggaagtat tgggtgatct
      121 attggagccg tacagcgatg aaattgcaaa atttgccggg tccataacat gtctgcaatt
      181 tttgtccggt gtttttctta tgaacgatat acgcaaaaag ggcagcagtg atgcatatcc
      241 cccggatccg ttcattggtg gtgttgtttt aacaatcctc agtttaaaac ttggaacact
      301 aatgggcgat gaggccatga ttaaagtcaa tgtcattggt tttgccatta atgttgtttt
      361 catggttatc ttctattggt atgcatcggg accgtttaaa tcaaaaatct ggtcgaaaat
      421 cggcattgca agtacattta caatggcctg tttggcctat tccaatttcg aggatcctgc
      481 caaaattgag ttccgttttg gaatgctgat tacagcaata ctggttatac ttgtgggtat
      541 gcctctactt agtcttggtg aaattatcga gaaaaagagt accgaaggtt taccattccc
      601 actgattttg tctggtacaa tagtggcagc agcatgggca gcgtatggca tatcgataag
      661 gaatgatgtt gttacgtatc aaaatctatt tttgcttctc ctaagttcaa tacaactttc
      721 gctgttcgcc atatatccaa acaatcccag cagtgccagt ccaaaggaaa aggatagccc
      781 tccatatagt aaattacaat cagatagtcc atccaagtcg aaaacaaata agaaacgcga
      841 ttaatggcac acacaaagca tcacgcgcgc aaattataaa ggcttactcg cttggctaag
      901 tgcaaaccca ttgactttca ttcaggttag agaagcaact aactgaaaaa gctcgtgaca
      961 tgcatgcagc agaataaaaa gctttaaacg caatacttat ggcacctaca catacatcta
     1021 acatttgaaa tcagctgtgc aaaacttttt gacaataatt aaaatcttcc aataacgtat
     1081 aacgataaa