Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245647 1085 bp mRNA linear INV 02-SEP-2023 (LOC106082898), transcript variant X2, mRNA. ACCESSION XM_013245647 VERSION XM_013245647.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245647.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1085 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1085 /gene="LOC106082898" /note="sugar transporter SWEET1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 10 Proteins" /db_xref="GeneID:106082898" CDS 97..840 /gene="LOC106082898" /codon_start=1 /product="sugar transporter SWEET1" /protein_id="XP_013101101.1" /db_xref="GeneID:106082898" /translation="MEVLGDLLEPYSDEIAKFAGSITCLQFLSGVFLMNDIRKKGSSD AYPPDPFIGGVVLTILSLKLGTLMGDEAMIKVNVIGFAINVVFMVIFYWYASGPFKSK IWSKIGIASTFTMACLAYSNFEDPAKIEFRFGMLITAILVILVGMPLLSLGEIIEKKS TEGLPFPLILSGTIVAAAWAAYGISIRNDVVTYQNLFLLLLSSIQLSLFAIYPNNPSS ASPKEKDSPPYSKLQSDSPSKSKTNKKRD" misc_feature 148..381 /gene="LOC106082898" /note="Sugar efflux transporter for intercellular exchange; Region: MtN3_slv; cl46784" /db_xref="CDD:481124" misc_feature 487..744 /gene="LOC106082898" /note="Sugar efflux transporter for intercellular exchange; Region: MtN3_slv; cl46784" /db_xref="CDD:481124" polyA_site 1085 /gene="LOC106082898" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agcccgtggc agctcgtttc tcgtttcgac ggcatcagca aaaaatactc tgtatacgac 61 gagagcacaa gcactgcaac aacgaccagt aacaacatgg aagtattggg tgatctattg 121 gagccgtaca gcgatgaaat tgcaaaattt gccgggtcca taacatgtct gcaatttttg 181 tccggtgttt ttcttatgaa cgatatacgc aaaaagggca gcagtgatgc atatcccccg 241 gatccgttca ttggtggtgt tgttttaaca atcctcagtt taaaacttgg aacactaatg 301 ggcgatgagg ccatgattaa agtcaatgtc attggttttg ccattaatgt tgttttcatg 361 gttatcttct attggtatgc atcgggaccg tttaaatcaa aaatctggtc gaaaatcggc 421 attgcaagta catttacaat ggcctgtttg gcctattcca atttcgagga tcctgccaaa 481 attgagttcc gttttggaat gctgattaca gcaatactgg ttatacttgt gggtatgcct 541 ctacttagtc ttggtgaaat tatcgagaaa aagagtaccg aaggtttacc attcccactg 601 attttgtctg gtacaatagt ggcagcagca tgggcagcgt atggcatatc gataaggaat 661 gatgttgtta cgtatcaaaa tctatttttg cttctcctaa gttcaataca actttcgctg 721 ttcgccatat atccaaacaa tcccagcagt gccagtccaa aggaaaagga tagccctcca 781 tatagtaaat tacaatcaga tagtccatcc aagtcgaaaa caaataagaa acgcgattaa 841 tggcacacac aaagcatcac gcgcgcaaat tataaaggct tactcgcttg gctaagtgca 901 aacccattga ctttcattca ggttagagaa gcaactaact gaaaaagctc gtgacatgca 961 tgcagcagaa taaaaagctt taaacgcaat acttatggca cctacacata catctaacat 1021 ttgaaatcag ctgtgcaaaa ctttttgaca ataattaaaa tcttccaata acgtataacg 1081 ataaa