Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans sugar transporter SWEET1


LOCUS       XM_013245647            1085 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082898), transcript variant X2, mRNA.
ACCESSION   XM_013245647
VERSION     XM_013245647.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245647.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1085
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1085
                     /gene="LOC106082898"
                     /note="sugar transporter SWEET1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1 EST,
                     10 Proteins"
                     /db_xref="GeneID:106082898"
     CDS             97..840
                     /gene="LOC106082898"
                     /codon_start=1
                     /product="sugar transporter SWEET1"
                     /protein_id="XP_013101101.1"
                     /db_xref="GeneID:106082898"
                     /translation="MEVLGDLLEPYSDEIAKFAGSITCLQFLSGVFLMNDIRKKGSSD
                     AYPPDPFIGGVVLTILSLKLGTLMGDEAMIKVNVIGFAINVVFMVIFYWYASGPFKSK
                     IWSKIGIASTFTMACLAYSNFEDPAKIEFRFGMLITAILVILVGMPLLSLGEIIEKKS
                     TEGLPFPLILSGTIVAAAWAAYGISIRNDVVTYQNLFLLLLSSIQLSLFAIYPNNPSS
                     ASPKEKDSPPYSKLQSDSPSKSKTNKKRD"
     misc_feature    148..381
                     /gene="LOC106082898"
                     /note="Sugar efflux transporter for intercellular
                     exchange; Region: MtN3_slv; cl46784"
                     /db_xref="CDD:481124"
     misc_feature    487..744
                     /gene="LOC106082898"
                     /note="Sugar efflux transporter for intercellular
                     exchange; Region: MtN3_slv; cl46784"
                     /db_xref="CDD:481124"
     polyA_site      1085
                     /gene="LOC106082898"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agcccgtggc agctcgtttc tcgtttcgac ggcatcagca aaaaatactc tgtatacgac
       61 gagagcacaa gcactgcaac aacgaccagt aacaacatgg aagtattggg tgatctattg
      121 gagccgtaca gcgatgaaat tgcaaaattt gccgggtcca taacatgtct gcaatttttg
      181 tccggtgttt ttcttatgaa cgatatacgc aaaaagggca gcagtgatgc atatcccccg
      241 gatccgttca ttggtggtgt tgttttaaca atcctcagtt taaaacttgg aacactaatg
      301 ggcgatgagg ccatgattaa agtcaatgtc attggttttg ccattaatgt tgttttcatg
      361 gttatcttct attggtatgc atcgggaccg tttaaatcaa aaatctggtc gaaaatcggc
      421 attgcaagta catttacaat ggcctgtttg gcctattcca atttcgagga tcctgccaaa
      481 attgagttcc gttttggaat gctgattaca gcaatactgg ttatacttgt gggtatgcct
      541 ctacttagtc ttggtgaaat tatcgagaaa aagagtaccg aaggtttacc attcccactg
      601 attttgtctg gtacaatagt ggcagcagca tgggcagcgt atggcatatc gataaggaat
      661 gatgttgtta cgtatcaaaa tctatttttg cttctcctaa gttcaataca actttcgctg
      721 ttcgccatat atccaaacaa tcccagcagt gccagtccaa aggaaaagga tagccctcca
      781 tatagtaaat tacaatcaga tagtccatcc aagtcgaaaa caaataagaa acgcgattaa
      841 tggcacacac aaagcatcac gcgcgcaaat tataaaggct tactcgcttg gctaagtgca
      901 aacccattga ctttcattca ggttagagaa gcaactaact gaaaaagctc gtgacatgca
      961 tgcagcagaa taaaaagctt taaacgcaat acttatggca cctacacata catctaacat
     1021 ttgaaatcag ctgtgcaaaa ctttttgaca ataattaaaa tcttccaata acgtataacg
     1081 ataaa