Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245646 1070 bp mRNA linear INV 02-SEP-2023 (LOC106082898), transcript variant X4, mRNA. ACCESSION XM_013245646 VERSION XM_013245646.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245646.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1070 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1070 /gene="LOC106082898" /note="sugar transporter SWEET1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106082898" CDS 82..825 /gene="LOC106082898" /codon_start=1 /product="sugar transporter SWEET1" /protein_id="XP_013101100.1" /db_xref="GeneID:106082898" /translation="MEVLGDLLEPYSDEIAKFAGSITCLQFLSGVFLMNDIRKKGSSD AYPPDPFIGGVVLTILSLKLGTLMGDEAMIKVNVIGFAINVVFMVIFYWYASGPFKSK IWSKIGIASTFTMACLAYSNFEDPAKIEFRFGMLITAILVILVGMPLLSLGEIIEKKS TEGLPFPLILSGTIVAAAWAAYGISIRNDVVTYQNLFLLLLSSIQLSLFAIYPNNPSS ASPKEKDSPPYSKLQSDSPSKSKTNKKRD" misc_feature 133..366 /gene="LOC106082898" /note="Sugar efflux transporter for intercellular exchange; Region: MtN3_slv; cl46784" /db_xref="CDD:481124" misc_feature 472..729 /gene="LOC106082898" /note="Sugar efflux transporter for intercellular exchange; Region: MtN3_slv; cl46784" /db_xref="CDD:481124" polyA_site 1070 /gene="LOC106082898" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agaagagaga taaaaaacat cagcaaaaaa tactctgtat acgacgagag cacaagcact 61 gcaacaacga ccagtaacaa catggaagta ttgggtgatc tattggagcc gtacagcgat 121 gaaattgcaa aatttgccgg gtccataaca tgtctgcaat ttttgtccgg tgtttttctt 181 atgaacgata tacgcaaaaa gggcagcagt gatgcatatc ccccggatcc gttcattggt 241 ggtgttgttt taacaatcct cagtttaaaa cttggaacac taatgggcga tgaggccatg 301 attaaagtca atgtcattgg ttttgccatt aatgttgttt tcatggttat cttctattgg 361 tatgcatcgg gaccgtttaa atcaaaaatc tggtcgaaaa tcggcattgc aagtacattt 421 acaatggcct gtttggccta ttccaatttc gaggatcctg ccaaaattga gttccgtttt 481 ggaatgctga ttacagcaat actggttata cttgtgggta tgcctctact tagtcttggt 541 gaaattatcg agaaaaagag taccgaaggt ttaccattcc cactgatttt gtctggtaca 601 atagtggcag cagcatgggc agcgtatggc atatcgataa ggaatgatgt tgttacgtat 661 caaaatctat ttttgcttct cctaagttca atacaacttt cgctgttcgc catatatcca 721 aacaatccca gcagtgccag tccaaaggaa aaggatagcc ctccatatag taaattacaa 781 tcagatagtc catccaagtc gaaaacaaat aagaaacgcg attaatggca cacacaaagc 841 atcacgcgcg caaattataa aggcttactc gcttggctaa gtgcaaaccc attgactttc 901 attcaggtta gagaagcaac taactgaaaa agctcgtgac atgcatgcag cagaataaaa 961 agctttaaac gcaatactta tggcacctac acatacatct aacatttgaa atcagctgtg 1021 caaaactttt tgacaataat taaaatcttc caataacgta taacgataaa