Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans sugar transporter SWEET1


LOCUS       XM_013245646            1070 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082898), transcript variant X4, mRNA.
ACCESSION   XM_013245646
VERSION     XM_013245646.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245646.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1070
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1070
                     /gene="LOC106082898"
                     /note="sugar transporter SWEET1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:106082898"
     CDS             82..825
                     /gene="LOC106082898"
                     /codon_start=1
                     /product="sugar transporter SWEET1"
                     /protein_id="XP_013101100.1"
                     /db_xref="GeneID:106082898"
                     /translation="MEVLGDLLEPYSDEIAKFAGSITCLQFLSGVFLMNDIRKKGSSD
                     AYPPDPFIGGVVLTILSLKLGTLMGDEAMIKVNVIGFAINVVFMVIFYWYASGPFKSK
                     IWSKIGIASTFTMACLAYSNFEDPAKIEFRFGMLITAILVILVGMPLLSLGEIIEKKS
                     TEGLPFPLILSGTIVAAAWAAYGISIRNDVVTYQNLFLLLLSSIQLSLFAIYPNNPSS
                     ASPKEKDSPPYSKLQSDSPSKSKTNKKRD"
     misc_feature    133..366
                     /gene="LOC106082898"
                     /note="Sugar efflux transporter for intercellular
                     exchange; Region: MtN3_slv; cl46784"
                     /db_xref="CDD:481124"
     misc_feature    472..729
                     /gene="LOC106082898"
                     /note="Sugar efflux transporter for intercellular
                     exchange; Region: MtN3_slv; cl46784"
                     /db_xref="CDD:481124"
     polyA_site      1070
                     /gene="LOC106082898"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agaagagaga taaaaaacat cagcaaaaaa tactctgtat acgacgagag cacaagcact
       61 gcaacaacga ccagtaacaa catggaagta ttgggtgatc tattggagcc gtacagcgat
      121 gaaattgcaa aatttgccgg gtccataaca tgtctgcaat ttttgtccgg tgtttttctt
      181 atgaacgata tacgcaaaaa gggcagcagt gatgcatatc ccccggatcc gttcattggt
      241 ggtgttgttt taacaatcct cagtttaaaa cttggaacac taatgggcga tgaggccatg
      301 attaaagtca atgtcattgg ttttgccatt aatgttgttt tcatggttat cttctattgg
      361 tatgcatcgg gaccgtttaa atcaaaaatc tggtcgaaaa tcggcattgc aagtacattt
      421 acaatggcct gtttggccta ttccaatttc gaggatcctg ccaaaattga gttccgtttt
      481 ggaatgctga ttacagcaat actggttata cttgtgggta tgcctctact tagtcttggt
      541 gaaattatcg agaaaaagag taccgaaggt ttaccattcc cactgatttt gtctggtaca
      601 atagtggcag cagcatgggc agcgtatggc atatcgataa ggaatgatgt tgttacgtat
      661 caaaatctat ttttgcttct cctaagttca atacaacttt cgctgttcgc catatatcca
      721 aacaatccca gcagtgccag tccaaaggaa aaggatagcc ctccatatag taaattacaa
      781 tcagatagtc catccaagtc gaaaacaaat aagaaacgcg attaatggca cacacaaagc
      841 atcacgcgcg caaattataa aggcttactc gcttggctaa gtgcaaaccc attgactttc
      901 attcaggtta gagaagcaac taactgaaaa agctcgtgac atgcatgcag cagaataaaa
      961 agctttaaac gcaatactta tggcacctac acatacatct aacatttgaa atcagctgtg
     1021 caaaactttt tgacaataat taaaatcttc caataacgta taacgataaa