Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082896


LOCUS       XM_013245643             736 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082896), mRNA.
ACCESSION   XM_013245643
VERSION     XM_013245643.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245643.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..736
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..736
                     /gene="LOC106082896"
                     /note="uncharacterized LOC106082896; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082896"
     CDS             82..450
                     /gene="LOC106082896"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082896"
                     /protein_id="XP_013101097.2"
                     /db_xref="GeneID:106082896"
                     /translation="MSKLSALLTICVLHAMANKKLTHAAAMPYTRNVAIDFMDTLHKL
                     RHTLLCTTNSCDPNAALQYFAINEGALLDIQEKTEFPETTEFLAKKVGTAASGALSRL
                     WPRNQIALTLTTLAPLPHST"
ORIGIN      
        1 attgcgagta aaaaaagcgc atatattgct gtacaatcat ataggtttga acattcattg
       61 aataacaaag cctgattgaa gatgtctaaa ctcagcgcat tattgacaat ttgcgttctt
      121 catgctatgg ccaataaaaa attaacacat gccgcagcaa tgccatatac aaggaatgtt
      181 gctattgatt ttatggacac tttacacaaa ctgcgtcata cattgctctg tacaacaaat
      241 agttgtgatc ccaatgctgc tctacaatat ttcgcgataa atgaaggcgc cctattggat
      301 attcaagaga aaaccgaatt tcctgaaaca acggaatttc tggccaaaaa agtcggtaca
      361 gccgcttcgg gtgctttatc tagactatgg ccgcggaacc aaattgcatt gaccctaact
      421 acacttgccc ctctcccaca ttcaacatag ttccagacga gctttatgaa tacatacatt
      481 ggctagaagc tatagtctca gctaaaaact gtataacacc ggagacccaa gaagatgcta
      541 ttgctgttgt ggcatccagt ggcaactata tagagcaaca tcttcaggac acagaaaatc
      601 ccataaaaag agtattacca attgtttcag atttggcgaa aaattttcaa aaattgtgcg
      661 cgcgataata actgtaataa agctatggaa aagtttaaaa tgtgacatac aaaacaaaaa
      721 attcaacaaa tcacaa