Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245643 736 bp mRNA linear INV 02-SEP-2023 (LOC106082896), mRNA. ACCESSION XM_013245643 VERSION XM_013245643.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245643.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..736 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..736 /gene="LOC106082896" /note="uncharacterized LOC106082896; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106082896" CDS 82..450 /gene="LOC106082896" /codon_start=1 /product="uncharacterized protein LOC106082896" /protein_id="XP_013101097.2" /db_xref="GeneID:106082896" /translation="MSKLSALLTICVLHAMANKKLTHAAAMPYTRNVAIDFMDTLHKL RHTLLCTTNSCDPNAALQYFAINEGALLDIQEKTEFPETTEFLAKKVGTAASGALSRL WPRNQIALTLTTLAPLPHST" ORIGIN 1 attgcgagta aaaaaagcgc atatattgct gtacaatcat ataggtttga acattcattg 61 aataacaaag cctgattgaa gatgtctaaa ctcagcgcat tattgacaat ttgcgttctt 121 catgctatgg ccaataaaaa attaacacat gccgcagcaa tgccatatac aaggaatgtt 181 gctattgatt ttatggacac tttacacaaa ctgcgtcata cattgctctg tacaacaaat 241 agttgtgatc ccaatgctgc tctacaatat ttcgcgataa atgaaggcgc cctattggat 301 attcaagaga aaaccgaatt tcctgaaaca acggaatttc tggccaaaaa agtcggtaca 361 gccgcttcgg gtgctttatc tagactatgg ccgcggaacc aaattgcatt gaccctaact 421 acacttgccc ctctcccaca ttcaacatag ttccagacga gctttatgaa tacatacatt 481 ggctagaagc tatagtctca gctaaaaact gtataacacc ggagacccaa gaagatgcta 541 ttgctgttgt ggcatccagt ggcaactata tagagcaaca tcttcaggac acagaaaatc 601 ccataaaaag agtattacca attgtttcag atttggcgaa aaattttcaa aaattgtgcg 661 cgcgataata actgtaataa agctatggaa aagtttaaaa tgtgacatac aaaacaaaaa 721 attcaacaaa tcacaa