Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245642 824 bp mRNA linear INV 02-SEP-2023 (LOC106082895), mRNA. ACCESSION XM_013245642 VERSION XM_013245642.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245642.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..824 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..824 /gene="LOC106082895" /note="uncharacterized LOC106082895; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106082895" CDS 143..730 /gene="LOC106082895" /codon_start=1 /product="uncharacterized protein LOC106082895" /protein_id="XP_013101096.2" /db_xref="GeneID:106082895" /translation="MSKLNIALLFCVLLVTVVNPTQAVDQKTDESLLKEFLDAFVNHV HTIRCLANSCDPLAINKVFDATNLEEDILSSQRDNVETDEFKTLKLSKAIEFATMNML MMEPKCNDPTFVCPYRVFNEIPQSIVDYTTKLETMIENTKCIPPNRVQEAIDILGKCI TYAEQFTDHKADYLKRVIPPIEYSIIEFGKLCAQA" polyA_site 824 /gene="LOC106082895" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ataaaaagta aatgttagca gagcttttta tataaaatca gttgtgtaca caatgaaatg 61 atttaaattt ttactataaa agccaaactt gaaatctaga gattacagat attaaagaga 121 cgatactgag atacgattca atatgtctaa gcttaacatt gcattgcttt tctgtgttct 181 tctagtaact gttgtgaacc ccacacaggc tgttgatcaa aaaaccgatg aaagcctact 241 taaggaattc ctcgatgcat ttgtcaatca tgtgcatacc atacgctgtc tagctaatag 301 ttgtgatccc ctggccatca ataaggtctt cgatgccacg aacctagagg aggatatcct 361 gagtagccaa agggacaatg tcgagaccga tgaatttaag actcttaagt tgtccaaagc 421 cattgaattt gccacaatga acatgttgat gatggagccc aaatgcaacg atcccacttt 481 tgtttgtcct tatagagtat ttaacgaaat tccacaatcc atcgttgact atacaactaa 541 attggagact atgatcgaaa acaccaaatg cattcccccc aaccgtgttc aggaagccat 601 cgatattctg ggtaaatgta ttacatatgc cgagcaattt acagatcata aggctgacta 661 cctgaagaga gtaatcccac caattgagta tagcattatc gaatttggta aattgtgtgc 721 acaagcttga ataagctaag gcattttttt ttttaaatta gaaattatgt tataaaaata 781 tgtaatatac caagaataat gttatttaca ttaaaaccag ttaa