Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082895


LOCUS       XM_013245642             824 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082895), mRNA.
ACCESSION   XM_013245642
VERSION     XM_013245642.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245642.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..824
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..824
                     /gene="LOC106082895"
                     /note="uncharacterized LOC106082895; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082895"
     CDS             143..730
                     /gene="LOC106082895"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082895"
                     /protein_id="XP_013101096.2"
                     /db_xref="GeneID:106082895"
                     /translation="MSKLNIALLFCVLLVTVVNPTQAVDQKTDESLLKEFLDAFVNHV
                     HTIRCLANSCDPLAINKVFDATNLEEDILSSQRDNVETDEFKTLKLSKAIEFATMNML
                     MMEPKCNDPTFVCPYRVFNEIPQSIVDYTTKLETMIENTKCIPPNRVQEAIDILGKCI
                     TYAEQFTDHKADYLKRVIPPIEYSIIEFGKLCAQA"
     polyA_site      824
                     /gene="LOC106082895"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ataaaaagta aatgttagca gagcttttta tataaaatca gttgtgtaca caatgaaatg
       61 atttaaattt ttactataaa agccaaactt gaaatctaga gattacagat attaaagaga
      121 cgatactgag atacgattca atatgtctaa gcttaacatt gcattgcttt tctgtgttct
      181 tctagtaact gttgtgaacc ccacacaggc tgttgatcaa aaaaccgatg aaagcctact
      241 taaggaattc ctcgatgcat ttgtcaatca tgtgcatacc atacgctgtc tagctaatag
      301 ttgtgatccc ctggccatca ataaggtctt cgatgccacg aacctagagg aggatatcct
      361 gagtagccaa agggacaatg tcgagaccga tgaatttaag actcttaagt tgtccaaagc
      421 cattgaattt gccacaatga acatgttgat gatggagccc aaatgcaacg atcccacttt
      481 tgtttgtcct tatagagtat ttaacgaaat tccacaatcc atcgttgact atacaactaa
      541 attggagact atgatcgaaa acaccaaatg cattcccccc aaccgtgttc aggaagccat
      601 cgatattctg ggtaaatgta ttacatatgc cgagcaattt acagatcata aggctgacta
      661 cctgaagaga gtaatcccac caattgagta tagcattatc gaatttggta aattgtgtgc
      721 acaagcttga ataagctaag gcattttttt ttttaaatta gaaattatgt tataaaaata
      781 tgtaatatac caagaataat gttatttaca ttaaaaccag ttaa