Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082892


LOCUS       XM_013245639             892 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082892), mRNA.
ACCESSION   XM_013245639
VERSION     XM_013245639.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245639.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..892
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..892
                     /gene="LOC106082892"
                     /note="uncharacterized LOC106082892; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082892"
     CDS             153..743
                     /gene="LOC106082892"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082892"
                     /protein_id="XP_013101093.1"
                     /db_xref="GeneID:106082892"
                     /translation="MSKFYLTFKFLVVVLVLAGNSAQALDTDYDIGMVKELIDQLTEE
                     RKVILCVANSCDPLAFNKLNEIADESEDFISSKVGFIETPEFETYKIDKSFEVFLPKL
                     LALVPECKDTSHVCPHKVFAPAPKYVFDYTNATKNMIEASKCITLDRVPEAIDIIAKS
                     VSYLEQYKDHKRNYLERALPAITYATNEFRKFCLKV"
     polyA_site      892
                     /gene="LOC106082892"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cataaaaacc atagcgatat aaaagtaact cttttttgta aacaaggctc taaggaaaat
       61 ccaaaaatac atttgtatat aaaacacgtc ggcaaataac taaatgtggc attaggcttt
      121 tagaaattgc aaagaacttc attccaatta aaatgtcaaa attctatcta actttcaagt
      181 ttttggttgt agtcctggtg cttgctggaa actcggcaca ggctcttgac actgactatg
      241 atatcggtat ggtcaaggaa cttatcgacc aactcactga ggaacgcaag gttatcttat
      301 gtgtggctaa tagttgtgat cccctggctt tcaacaagtt aaatgaaatc gctgacgaat
      361 cagaagattt tataagtagc aaagttggat ttatagaaac acccgaattt gagacctaca
      421 aaattgataa aagttttgaa gttttcttac ccaagctatt ggctcttgta cccgaatgca
      481 aagatacatc gcacgtttgc cctcacaaag tatttgcccc ggctccaaaa tatgtttttg
      541 actacaccaa tgcaacgaag aacatgattg aagctagcaa gtgtataacc ctggatcgcg
      601 taccagaagc tattgatatt atagctaaat ctgtaagcta tttggaacaa tataaggatc
      661 ataagcgaaa ctatcttgag agagcattgc ccgccattac atatgccacc aacgaattta
      721 gaaaattctg tttgaaagtt tagacttttg cacagaatga aatcgcagaa ttttactttt
      781 tagcgaaaag tttttggaaa attttgagaa aaataaaaaa gaacagtttt tggatgaatt
      841 acacagtgca tggggggtcc ctatgcactg agctaaaaac ttgtatagga ca