Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245639 892 bp mRNA linear INV 02-SEP-2023 (LOC106082892), mRNA. ACCESSION XM_013245639 VERSION XM_013245639.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245639.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..892 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..892 /gene="LOC106082892" /note="uncharacterized LOC106082892; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106082892" CDS 153..743 /gene="LOC106082892" /codon_start=1 /product="uncharacterized protein LOC106082892" /protein_id="XP_013101093.1" /db_xref="GeneID:106082892" /translation="MSKFYLTFKFLVVVLVLAGNSAQALDTDYDIGMVKELIDQLTEE RKVILCVANSCDPLAFNKLNEIADESEDFISSKVGFIETPEFETYKIDKSFEVFLPKL LALVPECKDTSHVCPHKVFAPAPKYVFDYTNATKNMIEASKCITLDRVPEAIDIIAKS VSYLEQYKDHKRNYLERALPAITYATNEFRKFCLKV" polyA_site 892 /gene="LOC106082892" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cataaaaacc atagcgatat aaaagtaact cttttttgta aacaaggctc taaggaaaat 61 ccaaaaatac atttgtatat aaaacacgtc ggcaaataac taaatgtggc attaggcttt 121 tagaaattgc aaagaacttc attccaatta aaatgtcaaa attctatcta actttcaagt 181 ttttggttgt agtcctggtg cttgctggaa actcggcaca ggctcttgac actgactatg 241 atatcggtat ggtcaaggaa cttatcgacc aactcactga ggaacgcaag gttatcttat 301 gtgtggctaa tagttgtgat cccctggctt tcaacaagtt aaatgaaatc gctgacgaat 361 cagaagattt tataagtagc aaagttggat ttatagaaac acccgaattt gagacctaca 421 aaattgataa aagttttgaa gttttcttac ccaagctatt ggctcttgta cccgaatgca 481 aagatacatc gcacgtttgc cctcacaaag tatttgcccc ggctccaaaa tatgtttttg 541 actacaccaa tgcaacgaag aacatgattg aagctagcaa gtgtataacc ctggatcgcg 601 taccagaagc tattgatatt atagctaaat ctgtaagcta tttggaacaa tataaggatc 661 ataagcgaaa ctatcttgag agagcattgc ccgccattac atatgccacc aacgaattta 721 gaaaattctg tttgaaagtt tagacttttg cacagaatga aatcgcagaa ttttactttt 781 tagcgaaaag tttttggaaa attttgagaa aaataaaaaa gaacagtttt tggatgaatt 841 acacagtgca tggggggtcc ctatgcactg agctaaaaac ttgtatagga ca