PREDICTED: Stomoxys calcitrans uncharacterized LOC106082884

LOCUS       XM_013245625             647 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082884), mRNA.
ACCESSION   XM_013245625
VERSION     XM_013245625.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245625.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 41% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..647
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..647
                     /gene="LOC106082884"
                     /note="uncharacterized LOC106082884; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082884"
     CDS             21..647
                     /gene="LOC106082884"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082884"
                     /protein_id="XP_013101079.2"
                     /db_xref="GeneID:106082884"
                     /translation="MVSQMYLRTASAVLLLLSCLHMTKADAPNQLEFLSQVAKDINVL
                     GKTALCHSVHGNDAEILSKAYKVYDTTVNGIKTSVDGPLTEEKFGTLLKILVHDTSAA
                     AKVVDPACSNAANYCPESDPPPQAATMAALGKALITLGSTFECLTANPNPEHLATVPV
                     IIGNAIQKVANHKGDSITSVGIILPEIIEIAVGFQSLSTTCANVAQPC"
ORIGIN      
        1 ttaactacta gccatacaag atggtcagtc agatgtattt gcgcacagca tccgcagttc
       61 tactcctgct atcatgtctt cacatgacca aagctgatgc tccaaatcag ctggagtttt
      121 taagccaagt agccaaggat ataaatgtgt tgggaaaaac cgctctatgc catagtgtac
      181 atggaaatga tgctgaaatt ctctcgaagg cttacaaagt ttatgacacc actgtgaacg
      241 gcattaagac cagtgtggat ggacctttga cagaagagaa atttggcacc ttgctaaaaa
      301 ttcttgtcca tgacacttcg gctgccgcaa aagttgtgga tcctgcatgt agtaatgctg
      361 caaattattg tcccgaatcg gatcctcccc ctcaggcagc caccatggca gcattgggta
      421 aagctttgat aacattgggt tccaccttcg aatgtttaac tgccaatccc aatccagagc
      481 accttgcaac ggtgcccgtc attattggca atgccataca gaaagtggca aaccataaag
      541 gtgactccat aacttcggtt ggtattatct tgccagaaat tattgaaatc gctgtgggat
      601 tccagtcttt gagtaccact tgtgcaaatg tcgcacaacc atgttaa