Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans V-type proton ATPase subunit F-like


LOCUS       XM_013245624             509 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082883), mRNA.
ACCESSION   XM_013245624
VERSION     XM_013245624.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245624.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..509
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..509
                     /gene="LOC106082883"
                     /note="V-type proton ATPase subunit F-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106082883"
     CDS             87..458
                     /gene="LOC106082883"
                     /codon_start=1
                     /product="V-type proton ATPase subunit F-like"
                     /protein_id="XP_013101078.2"
                     /db_xref="GeneID:106082883"
                     /translation="MDLDTPAHTHFVMDDGHRLLIAIIADETTTVGFLLAGIGECFGG
                     LGKKHINFMIVNKETNMNDVEKYFISIYEQSNIGVILIAADIWQHILPLYGKMKRRML
                     PIVLEIPIQNKDFLKITRKLN"
     polyA_site      509
                     /gene="LOC106082883"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttctaaaag tttcttcaat acaaaaattt caaaattttc gactaaattt ttcttcaaaa
       61 taaaaactta attataaaaa tttgcaatgg atttagacac accagcccat actcattttg
      121 taatggatga tggccatcgc ctactgattg ctattattgc agatgaaaca actacggtgg
      181 gatttctatt ggctggcatt ggtgaatgct ttggtggttt gggcaaaaag catatcaact
      241 ttatgattgt caataaagag acaaatatga atgatgtcga aaagtatttt atttcaattt
      301 acgaacaatc caacattggt gtaatactta ttgccgccga tatatggcag cacattttac
      361 ccttatatgg aaaaatgaag aggagaatgt tgccaattgt tttggaaata cccatacaaa
      421 ataaagattt tctcaaaata acgaggaaat taaattgaat gtgaaaacat taaaaacaag
      481 cgtgctaagt tcaaccgggc caaatctta