Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245624 509 bp mRNA linear INV 02-SEP-2023 (LOC106082883), mRNA. ACCESSION XM_013245624 VERSION XM_013245624.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245624.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..509 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..509 /gene="LOC106082883" /note="V-type proton ATPase subunit F-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106082883" CDS 87..458 /gene="LOC106082883" /codon_start=1 /product="V-type proton ATPase subunit F-like" /protein_id="XP_013101078.2" /db_xref="GeneID:106082883" /translation="MDLDTPAHTHFVMDDGHRLLIAIIADETTTVGFLLAGIGECFGG LGKKHINFMIVNKETNMNDVEKYFISIYEQSNIGVILIAADIWQHILPLYGKMKRRML PIVLEIPIQNKDFLKITRKLN" polyA_site 509 /gene="LOC106082883" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttctaaaag tttcttcaat acaaaaattt caaaattttc gactaaattt ttcttcaaaa 61 taaaaactta attataaaaa tttgcaatgg atttagacac accagcccat actcattttg 121 taatggatga tggccatcgc ctactgattg ctattattgc agatgaaaca actacggtgg 181 gatttctatt ggctggcatt ggtgaatgct ttggtggttt gggcaaaaag catatcaact 241 ttatgattgt caataaagag acaaatatga atgatgtcga aaagtatttt atttcaattt 301 acgaacaatc caacattggt gtaatactta ttgccgccga tatatggcag cacattttac 361 ccttatatgg aaaaatgaag aggagaatgt tgccaattgt tttggaaata cccatacaaa 421 ataaagattt tctcaaaata acgaggaaat taaattgaat gtgaaaacat taaaaacaag 481 cgtgctaagt tcaaccgggc caaatctta